Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-17A/IL-17A

Source: E.coli. MW :15.26kD. Recombinant Human Interleukin-17A is produced by our E.coli expression system and the target gene encoding Ile20-Ala155 is expressed. Interleukin-17 is a potent pro-inflammatory cytokine produced by activated memory T cells. There are at least six members of the IL-17 family in humans and in mice. As IL-17 shares properties with IL-1 and TNF-alpha, it may induce joint inflammation and bone and cartilage destruction. This cytokine is found in synovial fluids of patients with rheumatoid arthritis, and produced by rheumatoid arthritis synovium. It increases IL-6 production, induces collagen degradation and decreases collagen synthesis by synovium and cartilage and proteoglycan synthesis in cartilage. IL-17 is also able to increase bone destruction and reduce its formation. Blocking of interleukin-17 with specific inhibitors provides a protective inhibition of cartilage and bone degradation.

Product Specifications

Gene Name

IL17A

Gene ID

3605

UniProt

Q16552

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test. Biological Activity : ED50 is approximately 2 ng/ml. Specific Activity of 5 x 10^5 IU/mg.

Amino Acids

MIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rat Gpr150 Pre-designed siRNA Set B
SI205814B 1 Each

Rat Gpr150 Pre-designed siRNA Set B

Ask
View Details
Xylazine Monoclonal Antibody
TBS10037-0.2MG 0.2 mg

Xylazine Monoclonal Antibody

Ask
View Details
1',4-Dihydroxy triazolam discontinued
272407-01 1 mg

1',4-Dihydroxy triazolam discontinued

Ask
View Details
1',4-Dihydroxy triazolam discontinued
272407-02 2 mg

1',4-Dihydroxy triazolam discontinued

Ask
View Details
1',4-Dihydroxy triazolam discontinued
272407-03 5 mg

1',4-Dihydroxy triazolam discontinued

Ask
View Details
1',4-Dihydroxy triazolam discontinued
272407-04 10 mg

1',4-Dihydroxy triazolam discontinued

Ask
View Details