Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Leukemia Inhibitory Factor/LIF

Source: E.coli. MW :19.7kD. Recombinant Human Leukemia Inhibitory Factor is produced by our E.coli expression system and the target gene encoding Ser23-Phe202 is expressed. Leukemia Inhibitory Factor (LIF) is a lymphoid factor that promotes long-term maintenance of embryonic stem cells by suppressing spontaneous differentiation. LIF has a number of other activities including cholinergic neuron differentiation, control of stem cell pluripotency, bone and fat metabolism, mitogenesis of certain factor dependent cell lines and promotion of megakaryocyte production in vivo. Human and murine mature LIF exhibit a 78% sequence identity at the amino acid level. Human LIF is equally active on human and mouse cells. Murine LIF is approximately 1000 fold less active on human cells than human LIF.

Product Specifications

Gene Name

LIF

Gene ID

3976

UniProt

P15018

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 0.02% Tween 20, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test. Biological Activity : ED50 is less than 0.01 ng/ml. Specific Activity of 1.0 x 10^8 IU/mg.

Amino Acids

MSPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PCMV-SMARCD2-3xFLAG-Neo Plasmid
PVT72517 2 µg

PCMV-SMARCD2-3xFLAG-Neo Plasmid

Ask
View Details
Recombinant Staphylococcus epidermidis Uncharacterized protein SERP1457 (SERP1457)
MBS1353151-01 0.02 mg (E-Coli)

Recombinant Staphylococcus epidermidis Uncharacterized protein SERP1457 (SERP1457)

Ask
View Details
Recombinant Staphylococcus epidermidis Uncharacterized protein SERP1457 (SERP1457)
MBS1353151-02 0.02 mg (Yeast)

Recombinant Staphylococcus epidermidis Uncharacterized protein SERP1457 (SERP1457)

Ask
View Details
Recombinant Staphylococcus epidermidis Uncharacterized protein SERP1457 (SERP1457)
MBS1353151-03 0.1 mg (E-Coli)

Recombinant Staphylococcus epidermidis Uncharacterized protein SERP1457 (SERP1457)

Ask
View Details
Recombinant Staphylococcus epidermidis Uncharacterized protein SERP1457 (SERP1457)
MBS1353151-04 0.1 mg (Yeast)

Recombinant Staphylococcus epidermidis Uncharacterized protein SERP1457 (SERP1457)

Ask
View Details
Recombinant Staphylococcus epidermidis Uncharacterized protein SERP1457 (SERP1457)
MBS1353151-05 0.02 mg (Baculovirus)

Recombinant Staphylococcus epidermidis Uncharacterized protein SERP1457 (SERP1457)

Ask
View Details