Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Parathyroid Hormone/Parathormone/PTH (1-84)

Source: E.coli. MW :9kD. Recombinant Human Parathyroid Hormone is produced by our E.coli expression system and the target gene encoding Ser32-Gln115 is expressed. Parathyroid hormone is the most important endocrine regulator of calcium and phosphorus concentration in extracellular fluid. This hormone is secreted from cells of the parathyroid glands and finds its major target cells in bone and kidney. Another hormone, parathyroid hormone-related protein, binds to the same receptor as parathyroid hormone and has major effects on development. Like most other protein hormones, parathyroid hormone is synthesized as a preprohormone. After intracellular processing, the mature hormone is packaged within the Golgi into secretory vesicles, the secreted into blood by exocytosis. Parathyroid hormone is secreted as a linear protein of 84 amino acids.

Product Specifications

Gene Name

PTH

Gene ID

5741

UniProt

P01270

Components

Lyophilized from a 0.2 μm filtered solution of 10mM HAc-NaAc, 150mM NaCl, 5% Mannitol, pH 4.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test. Biological Activity : Specific Activity of 1.0 x 10^4 IU/mg.

Amino Acids

SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD43 (84-3C1), CF488A conjugate, 0.1mg/mL
BNC880342-500 1x 500 µL

CD43 (84-3C1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF405S conjugate, 0.1mg/mL
BNC040994-100 1x 100 µL

TNF alpha (J2D10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF647 conjugate, 0.1mg/mL
BNC470003-100 1x 100 µL

CD45RO (UCHL-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD79a (IGA/764), CF488A conjugate, 0.1mg/mL
BNC880764-100 1x 100 µL

CD79a (IGA/764), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRIM29 (TRIM29/1042), CF488A conjugate, 0.1mg/mL
BNC881042-100 1x 100 µL

TRIM29 (TRIM29/1042), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 5/8 (C-50), CF740 conjugate, 0.1mg/mL
BNC740948-100 1x 100 µL

Cytokeratin 5/8 (C-50), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details