Recombinant Human Interleukin-11/IL-11
Source: E. coli. MW :19kD. Recombinant Human Interleukin-11 is produced by our Yeast expression system and the target gene encoding Gly23-Leu199 is expressed. Interleukin 11 (IL-11) is a thrombopoietic growth factor that directly stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation resulting in increased platelet production. IL-11 is a member of a family of human growth factors that includes human growth hormone, granulocyte colony-stimulating factor, and other growth factors.
Product Specifications
Gene Name
IL11
Gene ID
3589
UniProt
P20809
Components
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 2% Glycine, pH 7.2.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
Applications Notes
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test. Biological Activity : ED50 is less than 0.2 ng/ml. Specific Activity of 8.0 x 10^6 IU/ mg, measured by the dose-dependent stimulation of murine 7TD1 proliferation.
Amino Acids
GPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC683636-500 1x 500 µL
Ornithine Decarboxylase-1 (ODC-1) (ODC1/3636R), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![Src Recombinant Rabbit Monoclonal Antibody [JF0947]](https://cdn.genprice.uk/products/992/68dd1c8a061270361ea80e20/imageurl/et1702-03.webp)
ET1702-03 100 µL
Src Recombinant Rabbit Monoclonal Antibody [JF0947]
Sign In for Pricing
View Details 