Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Granulocyte Colony-Stimulating Factor/G-CSF

Source: E. coli. MW:18.8kD. Recombinant Human Granulocyte Colony-Stimulating Factor is produced by our E.coli expression system and the target gene encoding Thr31-Pro204 is expressed. Human Granulocyte-Colony-Stimulating Factor (G-CSF) is 20 kD glycoprotein containing internal disulfide bonds. It induces the survival, proliferation, and differentiation of neutrophilic granulocyte precursor cells and it functionally activates mature blood neutrophils. Among the family of colony-stimulating factors, G-CSF is the most potent inducer of terminal differentiation to granulocytes and macrophages of leukemic myeloid cell lines. The synthesis of G-CSF can be induced by bacterial endotoxins, TNF, Interleukin-1, and GM-CSF. Prostaglandin E2 inhibits the synthesis of G-CSF. In epithelial, endothelial, and fibroblastic cells secretion of G-CSF is induced by Interleukin-17.

Product Specifications

Gene Name

CSF3

Gene ID

1440

UniProt

P09919

Components

Lyophilized from a 0.2 μm filtered solution of 10mM HAc-NaAc, 150mM NaCl, 0.004% Tween 80, 5% Mannitol, pH 4.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test. Biological Activity: ED50 is less than 0.1 ng/ml. Specific Activity of 6.0 x 10^7 IU/ mg, measured by the dose-dependent proliferation of murine NFS-60 indicator cells.

Amino Acids

MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OTK18 (E-9)
sc-393751 200 µg/mL

OTK18 (E-9)

Sign In for Pricing
View Details
SSR3 Antibody Blocking peptide
orb1454984 500 µg

SSR3 Antibody Blocking peptide

Sign In for Pricing
View Details
Rabbit anti-CaMKK alpha Antibody, Affinity Purified
A302-668A 100 µg

Rabbit anti-CaMKK alpha Antibody, Affinity Purified

Sign In for Pricing
View Details
2-Amino-4-Methylpyridine 98% For Synthesis
00160 00100 100 g

2-Amino-4-Methylpyridine 98% For Synthesis

Sign In for Pricing
View Details
TRM11 CRISPR Activation Plasmid (m2)
sc-428614-ACT-2 20 µg

TRM11 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
MonoMethyl-Histone H3 (Arg2) Rabbit mAb, 1 pack = 100 µL
BAL2918 1 Each

MonoMethyl-Histone H3 (Arg2) Rabbit mAb, 1 pack = 100 µL

Sign In for Pricing
View Details