Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Erythropoietin/EPO (C-6His)

Source: Human Cells. MW:19.2kD. Recombinant Human Erythropoietin is produced by our Mammalian expression system and the target gene encoding Ala28-Arg193 is expressed with a 6His tag at the C-terminus. Erythropoietin (EPO) is a glycoprotein hormone that is principally known for its role in erythropoiesis, where it is responsible for stimulating proliferation and differentiation of erythroid progenitor cells. Erythropoietin is a member of the EPO/TPO family. It is a secreted, glycosylated cytokine composed of four alpha helical bundles. The differentiation of CFU-E (Colony Forming Unit-Erythroid) cells into erythrocytes can only be accomplished in the presence of EPO. Physiological levels of EPO in adult mammals are maintained primarily by the kidneys, whereas levels in fetal or neonatal mammals are maintained by the liver. EPO also can exert various non-hematopoietic activities, including vascularization and proliferation of smooth muscle, neural protection during hypoxia, and stimulation of certain B cells. Genetic variation in erythropoietin is associated with susceptbility to microvascular complications of diabetes type 2. These are pathological conditions that develop in numerous tissues and organs as a consequence of diabetes mellitus. They include diabetic retinopathy, diabetic nephropathy leading to end-stage renal disease, and diabetic neuropathy.

Product Specifications

Gene Name

EPO

Gene ID

2056

UniProt

P01588

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDRHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ZBTB9 Antibody
MBS9410217-01 0.1 mL

ZBTB9 Antibody

Ask
View Details
ZBTB9 Antibody
MBS9410217-02 5x 0.1 mL

ZBTB9 Antibody

Ask
View Details
sRANKL (Receptor Activator of Nuclear Factor kappa B Ligand, Receptor Activator of NFkB Ligand, CD254, hRANKL2, hRANKL-2, Osteoclast Differentiation Factor, ODF, Osteoprotegerin Ligand, OPGL, sOdf, SOFA, TNF-related Activation-induced Cytokine, TRANCE, Tu
MBS6225634-01 0.1 mL

sRANKL (Receptor Activator of Nuclear Factor kappa B Ligand, Receptor Activator of NFkB Ligand, CD254, hRANKL2, hRANKL-2, Osteoclast Differentiation Factor, ODF, Osteoprotegerin Ligand, OPGL, sOdf, SOFA, TNF-related Activation-induced Cytokine, TRANCE, Tu

Ask
View Details
sRANKL (Receptor Activator of Nuclear Factor kappa B Ligand, Receptor Activator of NFkB Ligand, CD254, hRANKL2, hRANKL-2, Osteoclast Differentiation Factor, ODF, Osteoprotegerin Ligand, OPGL, sOdf, SOFA, TNF-related Activation-induced Cytokine, TRANCE, Tu
MBS6225634-02 5x 0.1 mL

sRANKL (Receptor Activator of Nuclear Factor kappa B Ligand, Receptor Activator of NFkB Ligand, CD254, hRANKL2, hRANKL-2, Osteoclast Differentiation Factor, ODF, Osteoprotegerin Ligand, OPGL, sOdf, SOFA, TNF-related Activation-induced Cytokine, TRANCE, Tu

Ask
View Details
Protein Phosphatase 1 Catalytic Subunit Gamma (PPP1CC) Antibody
abx236697 100 µg

Protein Phosphatase 1 Catalytic Subunit Gamma (PPP1CC) Antibody

Ask
View Details
LEP (Leptin, FLJ94114, OB, OBS) (MaxLight 550)
MBS6217815-01 0.1 mL

LEP (Leptin, FLJ94114, OB, OBS) (MaxLight 550)

Ask
View Details