Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OPG Human, HEK

Source: HEK293 Cells.Sterile Filtered White lyophilized (freeze-dried) powder.Osteoprotegerin acts as decoy receptor for rankl and thereby neutralizes its function in osteoclastogenesis. OPG inhibits the activation of osteoclasts and promotes osteoclast apoptosis in vitro. Bone homeostasis seems to depend on the local rankl/opg ratio. Osteoprotegerin may also play a role in preventing arterial calcification. May act as decoy receptor for trail and protect against apoptosis. Trail binding blocks the inhibition of osteoclastogenesis.OPG Human Recombinant is a single, glycosylated polypeptide chain containing 393 amino acids (22-401a.a) and having a molecular mass of 45.0kDa (calculated) . OPG is fused to a 13 a.a FLAG- tag at N-terminal.

Product Specifications

Product Name Alternative

TNFRSF11B, OPG, OCIF, Osteoclastogenesis inhibitory factor, Osteoprotegerin, TR1, MGC29565.

Purification

Greater than 90.0% as determined by SDS-PAGE.

Components

OPG filtered (0.4 μm) and lyophilized from 0.5mg/mL solution in PBS, pH7.5 and 5% (w/v) Trehalose.It is recommended to add deionized water to prepare a working stock solution of approximately 0.5mg/mL and let the lyophilized pellet dissolve completely.

Storage Conditions

Store lyophilized protein at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after two weeks at 4°C.

Amino Acids

PGDYKDDDDKPAGETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYC SPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAP CRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESV ERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEK TIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UPK1A Antibody / Uroplakin 1A
V7672-100UG 100 µg

UPK1A Antibody / Uroplakin 1A

Sign In for Pricing
View Details
MYO10 Rabbit Polyclonal Antibody
orb1544278-01 50 μL

MYO10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MYO10 Rabbit Polyclonal Antibody
orb1544278-02 100 µL

MYO10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lung Resistance Protein (LRP, Multi Drug Resistance Associated Protein, MDR Protein) (Biotin)
L7360-03B 100 µg

Lung Resistance Protein (LRP, Multi Drug Resistance Associated Protein, MDR Protein) (Biotin)

Sign In for Pricing
View Details
SID 26681509 10mM * 1mL in DMSO
A15313-10mM-D 10 mM x 1mL in DMSO

SID 26681509 10mM * 1mL in DMSO

Sign In for Pricing
View Details
PKIG Human Over-expression Lysate
orb1367652 20 µg

PKIG Human Over-expression Lysate

Sign In for Pricing
View Details