Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GH Rainbow Trout

Source: Escherichia Coli.Sterile Filtered White lyophilized (freeze-dried) powder.GH is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the growth hormone locus on chromosome 17 where they are interspersed in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. The five genes share a remarkably high degree of sequence identity. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. This particular family member is expressed in the pituitary but not in placental tissue as is the case for the other four genes in the growth hormone locus. Mutations in or deletions of the gene lead to growth hormone deficiency and short stature.Somatotropin Rainbow Trout (Oncorhynchus mykiss) Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 188 amino acids with an additional Ala at the N-terminus and having a molecular mass of 21, 535 Dalton. The Rainbow Trout (Oncorhynchus mykiss) Growth-Hormone Recombinant is purified by proprietary chromatographic techniques.

Product Specifications

Product Name Alternative

GH1, GH, GHN, GH-N, hGH-N, Pituitary growth hormone, Growth hormone 1, Somatotropin.

Applications

Functional Assay

Purification

Greater than 95.0% as determined by: (a) Analysis by SEC-HPLC. (b) Analysis by SDS-PAGE.

Components

The protein was lyophilized from a concentrated (1mg/mL) solution with 0.5% NaHCO3. Adjusted to pH-8.It is recommended to reconstitute the lyophilized Growth-Hormone Rainbow Trout (Oncorhynchus mykiss) in 0.4% NaHCO3 or water adjusted to pH 8-9, not less than 100μg/ml and not more than 3mg/mL, which can then be further diluted to other aqueous solutions, preferably in a presence of a carrier protein such as BSA or similar.

Storage Conditions

Lyophilized Growth-Hormone Rainbow Trout (Oncorhynchus mykiss) although stable at room temperature for at least two weeks, should be stored desiccated below -18°C. Upon reconstitution and filter sterilization GH can be stored at 4°C, pH 9 for up to 4 weeks. For long term storage and more diluted solutions it is recommended to add a carrier protein (0.1% HSA or BSA) . Please prevent freeze-thaw cycles.

Applications Notes

Somatotropin Rainbow Trout (Oncorhynchus mykiss) Recombinant is biologically active in PDF-P1 3B9 cells stable transfected with rabbit GH receptors, though its activity is about 10 fold lower than that of human GH.

Amino Acids

AIENQRLFNIAVSRVQHLHLLAQKMFNDFDGTLLPDERRQLNKIFLLDFCNSDSIVSPVDKHETQKSSVLKLLHISFRLIESWEYPSQTLIISNSLMVRNANQISEKLSDLKVGINLLITGSQDGVLSLDDNDSQQLPPYGNYYQNLGGDGNVRRNYELLACFKKDMHKVETYLTVAKCRKSLEANCTL.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CERS6 Antibody
A45904-50UL 50 μL

CERS6 Antibody

Sign In for Pricing
View Details
ADD2 siRNA (Human)
CRH0081-01 15 nmol

ADD2 siRNA (Human)

Sign In for Pricing
View Details
ADD2 siRNA (Human)
CRH0081-02 30 nmol

ADD2 siRNA (Human)

Sign In for Pricing
View Details
TTC36 Rabbit Polyclonal Antibody (Fluoro488)
orb3092232 100 µg

TTC36 Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
Pnkd (NM_001039509) Mouse Tagged ORF Clone Lentiviral Particle
MR224993L4V 200 µL

Pnkd (NM_001039509) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
General Endotoxin ELISA Kit
orb1631157 96 Tests

General Endotoxin ELISA Kit

Sign In for Pricing
View Details