Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Papillomavirus 11

Source: E.Coli. Human papillomaviruses (HPVs) are a group family with more than 150 related viruses. HP 6 and 11 considered as low-risk HPVs can be sexually transmitted, causing warts to emerge on or around the genitals or anus, known as condylomata acuminate. HPV 11 major/large capsid antigen is used in clinical diagnosis to test the specific antibody to this virus-induced by the virus infection, the positive reaction of this antibody is deemed as a marker for present and past infection. Furthermore, HPV 11 large capsid is used as a potential candidate for vaccine development. Recombinant HPV-11 antigen is a 58.1kDa protein covering the full length of HPV-11 major capsid, its N-terminus is fused with a GST tag, having a total molecular weight of 84kDa. The HPV-11 was purified by proprietary chromatographic technique.

Product Specifications

Product Name Alternative

Papillomavirus||HPV||Papilloma Virus.

Purification

Protein is >95% pure as determined by 12% PAGE (coomassie staining) .

Components

Recombinant HPV11 solution in PBS and 3M Urea, 100mM arginine

Storage Conditions

Recombinant HPV-11 although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.

Amino Acids

VDKLWRPSDSTVYVPPPNPVSKVVATDAYVKRTNIFYHASSSRLLAVGHPYYSIKKVNKTVVPKVSGYQYRVFKVVLPDPNKFALPDSSLFDPTTQRLVWACTGLEVGRGQPLGVGVSGHPLLNKYDDVENSGGYGGNPGQDNRVNVGMDYKQTQLCMVGCAPPLGEHWGKGTQCSNTSVQNGDCPPLELITSVIQDGDMVDTGFGAMNFADLQTNKSDVPLDICGTVCKYPDYLQMAADPYGDRLFFYLRKEQMFARHFFNRAGTVGEPVPDDLLVKGGNNRSSVASSIYVHTPSGSLVSSEAQLFNKPYWLQKAQGHNNGICWGNHLFVTVVDTTRSTNMTLCASVSKSATYTNSDYKEYMRHVEEFDLQFIFQLCSITLSAEVMAYIHTMNPSVLEDWNFGLSPPPNGTLEDTYRYVQSQAITCQKPTPEKEKQDPYKDMSFWEVNLKEKFSSELDQFPLGRKFLLQSGYRGRTSARTGIKRPAVSKPSTAPKRKRTKTKKKFGTKLSR.
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Tissue Total RNA, Breast
CR562278 5 µg

Tissue Total RNA, Breast

Ask
View Details
Tungsten Trioxide
T9351-01 10 g

Tungsten Trioxide

Ask
View Details
Tungsten Trioxide
T9351-02 25 g

Tungsten Trioxide

Ask
View Details
CAF-1, NT (CNOT7, CAF1, CCR4-NOT transcription complex subunit 7, BTG1-binding factor 1, CCR4-associated factor 1) (MaxLight 750)
MBS6280483-01 0.1 mL

CAF-1, NT (CNOT7, CAF1, CCR4-NOT transcription complex subunit 7, BTG1-binding factor 1, CCR4-associated factor 1) (MaxLight 750)

Ask
View Details
CAF-1, NT (CNOT7, CAF1, CCR4-NOT transcription complex subunit 7, BTG1-binding factor 1, CCR4-associated factor 1) (MaxLight 750)
MBS6280483-02 5x 0.1 mL

CAF-1, NT (CNOT7, CAF1, CCR4-NOT transcription complex subunit 7, BTG1-binding factor 1, CCR4-associated factor 1) (MaxLight 750)

Ask
View Details
SLC10A1 (NM_003049) Human Tagged ORF Clone Lentiviral Particle
RC210241L1V 200 µL

SLC10A1 (NM_003049) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details