Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Papillomavirus 6

Source : E.Coli. Human papillomaviruses (HPVs) are a group family with more than 150 related viruses. HP 6 and 11 considered as low-risk HPVs can be sexually transmitted, causing warts to emerge on or around the genitals or anus, known as condylomata acuminate. HPV-6 major/large capsid antigen is used in clinical diagnosis to test the specific antibody to this virus induced by the virus infection, the positive reaction of this antibody is deemed as a marker for present and past infection. Furthermore, HPV-6 large capsid is used as a potential candidate for vaccine development.

Product Specifications

Product Name Alternative

Papillomavirus||HPV||Papilloma Virus.

Purification

Protein is >95% pure as determined by 12% PAGE (coomassie staining) .

Components

PBS, 20mM Arginine, 0.6M Urea and 0.02% Sodium Azide.

Storage Conditions

Recombinant HPV-6 although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.

Amino Acids

VDVPPPNPVSKVVATDAYVTRTNIFYHASSSRLLAVGHPYFSIKRANKTVVPKVSGYQYRVFKVVLPDPNKFALPDSSLFDPTTQRLVWACTGLEVGRGQPLGVGVSGHPFLNKYDDVENSGSGGNPGQDNRVNVGMDYKQTQLCMVGCAPPLGEHWGKGKQCTNTPVQAGDCPPLELITSVIQDGDMVDTGFGAMNFADLQTNKSDVPIDICGTTCKYPDYLQMAADPYGDRLFFFLRKEQMFARHFFNRAGEVGEPVPDTLIIKGSGNRTSVGSSIYVNTPSGSLVSSEAQLFNKPYWLQKAQGHNNGICWGNQLFVTVVDTTRSTNMTLCASVTTSSTYTNSDYKEYMRHVEEYDLQFIFQLCSITLSAEVMAYIHTMNPSVLEDWNFGLSPPPNGTLEDTYRYVQSQAITCQKPTPEKEKPDPYKNLSFWEVNLKEKFSSELDQYPLGRKFLLQSGYRGRSSIRTGVKRPAVSKASAAPKRKRAK.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chloroiodoacetic Acid
TRC-C367170-10MG 10 mg

Chloroiodoacetic Acid

Sign In for Pricing
View Details
Recombinant Human GM-CSF/CSF2 Protein (HEK293 Cells)
PKSH031982 20 µg

Recombinant Human GM-CSF/CSF2 Protein (HEK293 Cells)

Sign In for Pricing
View Details
CD43 (T-Cell Marker) (rSPN/1094), CF647 conjugate, 0.1mg/mL
BNC471858-500 1x 500 µL

CD43 (T-Cell Marker) (rSPN/1094), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MRC2 (Center) Rabbit Polyclonal Antibody
AP52744PU-N 400 µL

MRC2 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD20 / MS4A1 (B-Cell Marker) (IGEL/1497R), Biotin conjugate, 0.1mg/mL
BNCB1497-500 1x 500 µL

CD20 / MS4A1 (B-Cell Marker) (IGEL/1497R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2602), CF568 conjugate, 0.1mg/mL
BNC682602-500 1x 500 µL

Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2602), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details