Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Papillomavirus 6

Source : E.Coli. Human papillomaviruses (HPVs) are a group family with more than 150 related viruses. HP 6 and 11 considered as low-risk HPVs can be sexually transmitted, causing warts to emerge on or around the genitals or anus, known as condylomata acuminate. HPV-6 major/large capsid antigen is used in clinical diagnosis to test the specific antibody to this virus induced by the virus infection, the positive reaction of this antibody is deemed as a marker for present and past infection. Furthermore, HPV-6 large capsid is used as a potential candidate for vaccine development.

Product Specifications

Product Name Alternative

Papillomavirus||HPV||Papilloma Virus.

Purification

Protein is >95% pure as determined by 12% PAGE (coomassie staining) .

Components

PBS, 20mM Arginine, 0.6M Urea and 0.02% Sodium Azide.

Storage Conditions

Recombinant HPV-6 although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.

Amino Acids

VDVPPPNPVSKVVATDAYVTRTNIFYHASSSRLLAVGHPYFSIKRANKTVVPKVSGYQYRVFKVVLPDPNKFALPDSSLFDPTTQRLVWACTGLEVGRGQPLGVGVSGHPFLNKYDDVENSGSGGNPGQDNRVNVGMDYKQTQLCMVGCAPPLGEHWGKGKQCTNTPVQAGDCPPLELITSVIQDGDMVDTGFGAMNFADLQTNKSDVPIDICGTTCKYPDYLQMAADPYGDRLFFFLRKEQMFARHFFNRAGEVGEPVPDTLIIKGSGNRTSVGSSIYVNTPSGSLVSSEAQLFNKPYWLQKAQGHNNGICWGNQLFVTVVDTTRSTNMTLCASVTTSSTYTNSDYKEYMRHVEEYDLQFIFQLCSITLSAEVMAYIHTMNPSVLEDWNFGLSPPPNGTLEDTYRYVQSQAITCQKPTPEKEKPDPYKNLSFWEVNLKEKFSSELDQYPLGRKFLLQSGYRGRSSIRTGVKRPAVSKASAAPKRKRAK.
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Caenorhabditis elegans Mediator of RNA polymerase II transcription subunit 4 (mdt-4)
MBS1374092-01 0.02 mg (E-Coli)

Recombinant Caenorhabditis elegans Mediator of RNA polymerase II transcription subunit 4 (mdt-4)

Ask
View Details
Recombinant Caenorhabditis elegans Mediator of RNA polymerase II transcription subunit 4 (mdt-4)
MBS1374092-02 0.02 mg (Yeast)

Recombinant Caenorhabditis elegans Mediator of RNA polymerase II transcription subunit 4 (mdt-4)

Ask
View Details
Recombinant Caenorhabditis elegans Mediator of RNA polymerase II transcription subunit 4 (mdt-4)
MBS1374092-03 0.1 mg (E-Coli)

Recombinant Caenorhabditis elegans Mediator of RNA polymerase II transcription subunit 4 (mdt-4)

Ask
View Details
Recombinant Caenorhabditis elegans Mediator of RNA polymerase II transcription subunit 4 (mdt-4)
MBS1374092-04 0.1 mg (Yeast)

Recombinant Caenorhabditis elegans Mediator of RNA polymerase II transcription subunit 4 (mdt-4)

Ask
View Details
Recombinant Caenorhabditis elegans Mediator of RNA polymerase II transcription subunit 4 (mdt-4)
MBS1374092-05 0.02 mg (Baculovirus)

Recombinant Caenorhabditis elegans Mediator of RNA polymerase II transcription subunit 4 (mdt-4)

Ask
View Details
Recombinant Caenorhabditis elegans Mediator of RNA polymerase II transcription subunit 4 (mdt-4)
MBS1374092-06 0.02 mg (Mammalian-Cell)

Recombinant Caenorhabditis elegans Mediator of RNA polymerase II transcription subunit 4 (mdt-4)

Ask
View Details