Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Papillomavirus 6

Source : E.Coli. Human papillomaviruses (HPVs) are a group family with more than 150 related viruses. HP 6 and 11 considered as low-risk HPVs can be sexually transmitted, causing warts to emerge on or around the genitals or anus, known as condylomata acuminate. HPV-6 major/large capsid antigen is used in clinical diagnosis to test the specific antibody to this virus induced by the virus infection, the positive reaction of this antibody is deemed as a marker for present and past infection. Furthermore, HPV-6 large capsid is used as a potential candidate for vaccine development.

Product Specifications

Product Name Alternative

Papillomavirus||HPV||Papilloma Virus.

Purification

Protein is >95% pure as determined by 12% PAGE (coomassie staining) .

Components

PBS, 20mM Arginine, 0.6M Urea and 0.02% Sodium Azide.

Storage Conditions

Recombinant HPV-6 although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.

Amino Acids

VDVPPPNPVSKVVATDAYVTRTNIFYHASSSRLLAVGHPYFSIKRANKTVVPKVSGYQYRVFKVVLPDPNKFALPDSSLFDPTTQRLVWACTGLEVGRGQPLGVGVSGHPFLNKYDDVENSGSGGNPGQDNRVNVGMDYKQTQLCMVGCAPPLGEHWGKGKQCTNTPVQAGDCPPLELITSVIQDGDMVDTGFGAMNFADLQTNKSDVPIDICGTTCKYPDYLQMAADPYGDRLFFFLRKEQMFARHFFNRAGEVGEPVPDTLIIKGSGNRTSVGSSIYVNTPSGSLVSSEAQLFNKPYWLQKAQGHNNGICWGNQLFVTVVDTTRSTNMTLCASVTTSSTYTNSDYKEYMRHVEEYDLQFIFQLCSITLSAEVMAYIHTMNPSVLEDWNFGLSPPPNGTLEDTYRYVQSQAITCQKPTPEKEKPDPYKNLSFWEVNLKEKFSSELDQYPLGRKFLLQSGYRGRSSIRTGVKRPAVSKASAAPKRKRAK.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GCAP1 (GUCA1A) (C-term) Rabbit Polyclonal Antibody
AP11600PU-N 400 µL

GCAP1 (GUCA1A) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HS3ST6 (NM_001009606) Human Over-expression Lysate
LC422922 20 µg

HS3ST6 (NM_001009606) Human Over-expression Lysate

Sign In for Pricing
View Details
Cefteram Pivoxil
TRC-C244300-25MG 25 mg

Cefteram Pivoxil

Sign In for Pricing
View Details
TAT Mouse Monoclonal Antibody [Clone ID: OTI3G6]
CF809923 100 µg

TAT Mouse Monoclonal Antibody [Clone ID: OTI3G6]

Sign In for Pricing
View Details
Retinal protein 4 (UNC119) (Center) Rabbit Polyclonal Antibody
AP54459PU-N 400 µL

Retinal protein 4 (UNC119) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CDX2 Antibody
KC-149-01 50 μL

CDX2 Antibody

Sign In for Pricing
View Details