Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Papillomavirus 18

Source : E.Coli The Recombinant HPV-18 is a full length large capsid protein having a Mw of 56kDa expressed in E. coli and fused to a GST-Tag, having a total Mw of 83kDa, purified by standard chromatography. Human papillomavirus family consist of over 200 types. Over than 30 to 40 types of HPV are transferred via sexual contact and infect the anogenital region initiating genital warts. Persistent infection with 'high-risk' HPV types results in skin warts and leads to precancerous lesions and invasive cancer. HPV infection is considered as a source for all incidents of cervical cancer. E2, E6, and E7 proteins of HPV-16 and 18 are considered the main viral oncoproteins that take part in cervical cancer. The type-specific antigen epitopes of E2, E6, and E7 proteins of HPV-16 are fused together and expressed in E. coli for diagnostic purpose.

Product Specifications

Product Name Alternative

Papillomavirus||HPV||Papilloma Virus.

Purification

Protein is >95% pure as determined by 12% PAGE (Coomassie staining) .

Components

Recombinant HPV-18 solution in Phosphate buffer and 3M Urea and 0.02% sodium azide as preservative.

Amino Acids

VDVYLPPPSVARVVNTDDYVTPTSIFYHAGSSRLLTVGNPYFRVPAGGGNKQDIPKVSAYQYRVFRVQLPDPNKFGLPDTSIYNPETQRLVWACAGVEIGRGQPLGVGLSGHPFYNKLDDTESSHAATSNVSEDVRDNVSVDYKQTQLCILGCAPAIGEHWAKGTACKSRPLSQGDCPPLELKNTVLEDGDMVDTGYGAMDFSTLQDTKCEVPLDICQSICKYPDYLQMSADPYGDSMFFCLRREQLFARHFWNRAGTMGDTVPQSLYIKGTGMPASPGSCVYSPSPSGSIVTSDSQLFNKPYWLHKAQGHNNGVCWHNQLFVTVVDTTPSTNLTICASTQSPVPGQYDATKFKQYSRHVEEYDLQFIFQLCTITLTADVMSYIHSMNSSILEDWNFGVPPPPTTSLVDTYRFVQSVAITCQKDAAPAENKDPYDKLKFWNVDLKEKFSLDLDQYPLGRKFLVQAGLRRKPTIGPRKRSAPSATTSSKPA.
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal Neuronal Pentraxin 1 Antibody (OTI5G9) [DyLight 755]
NBP2-72965IR 0.1 mL

Mouse Monoclonal Neuronal Pentraxin 1 Antibody (OTI5G9) [DyLight 755]

Ask
View Details
Zfp57 Antibody
MBS9612243-01 0.1 mL

Zfp57 Antibody

Ask
View Details
Zfp57 Antibody
MBS9612243-02 0.2 mL

Zfp57 Antibody

Ask
View Details
Zfp57 Antibody
MBS9612243-03 5x 0.2 mL

Zfp57 Antibody

Ask
View Details
[D-Ala2, Met5]-Beta-Casomorphin (1-5) amide (Bovine)
CCP1560-01 1 mg

[D-Ala2, Met5]-Beta-Casomorphin (1-5) amide (Bovine)

Ask
View Details
[D-Ala2, Met5]-Beta-Casomorphin (1-5) amide (Bovine)
CCP1560-02 5 mg

[D-Ala2, Met5]-Beta-Casomorphin (1-5) amide (Bovine)

Ask
View Details