Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant HIV-2 gp36 397 a.a

Source : Escherichia Coli. HIV-2 gp36 34 kDa recombinant has 397 amino acids and contains the sequence of HIV-2 envelope immunodominant regions gp36. The protein is fused to beta-galactosidase (114 kDa) at N-terminus. HIV-1 and HIV-2 appear to package their RNA differently. HIV-1 binds to any appropriate RNA whereas HIV-2 preferentially binds to mRNA which creates the Gag protein itself. This means that HIV-1 is better able to mutate. HIV-2 is transmitted in the same ways as HIV-1: Through exposure to bodily fluids such as blood, semen, tears and vaginal fluids. Immunodeficiency develops more slowly with HIV-2.HIV-2 is less infectious in the early stages of the virus than with HIV-1.The infectiousness of HIV-2 increases as the virus progresses.Major differences include reduced pathogenicity of HIV-2 relative to HIV-1, enhanced immune control of HIV-2 infection and often some degree of CD4-independence. Despite considerable sequence and phenotypic differences between HIV-1 and 2 envelopes, structurally they are quite similar. Both membrane-anchored proteins eventually form the 6-helix bundles from the N-terminal and C-terminal regions of the ectodomain, which is common to many viral and cellular fusion proteins and which seems to drive fusion. HIV-1 gp41 helical regions can form more stable 6-helix bundles than HIV-2 gp41 helical regions however HIV-2 fusion occurs at a lower threshold temperature (25°C), does not require Ca2+ in the medium, is insensitive to treatment of target cells with cytochalasin B, and is not affected by target membrane glycosphingolipid composition.

Product Specifications

Purification

Greater than 95.0% as determined by HPLC analysis and SDS-PAGE.

Components

0.01M Na2CO3, 0.01M Na3EDTA, 0.014 M Beta-mercaptoethanol, 0.02% Sarcosyl.

Storage Conditions

Protein should be stored at 4°C.Refrigerate Upon arrival. DO NOT FREEZE.

Amino Acids

EQTMVQDDPSTCRGEFLYCNMTWFLNWIENKTHRNYAPCHIKQIINTWHKVGRNVYLPPREGELSCNSTVTSIIANIDWQNNNQTNITFSAEVAELYRLELGDYKLVEITPIGFAPTKEKRYSSAHGRHTRGVFVLGFLGFLATAGSAMGAASLTVSAQSRTLLAGIVQQQQQLLDVVKRQQELLRLTVWGTKNLQARVTAIEKYLQDQARLNSWGCAFRQVCHTTVPWVNDSLAPDWDNMTWQEWEKQVRYLEANISKSLEQAQIQQEKNMYELQKLNSWDIFGNWFDLTSWVKYIQYGVLIIVAVIALRIVIYVVQMLSRLRKGYRPVFSSPPGYIQQIHIHKDRGQPANEETEEDGGSNGGDRYWPWPIAYIHFLIRQLIRLLTRLYSICSQAC.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alpha-Synuclein Recombinant Rabbit Monoclonal Antibody [JB42-33]
ET7107-31 100 µL

Alpha-Synuclein Recombinant Rabbit Monoclonal Antibody [JB42-33]

Sign In for Pricing
View Details
Forget-Me-NotTM EvaGreen® qPCR Master Mix (2000 reactions)
#31041-20mL 2x 10 mL

Forget-Me-NotTM EvaGreen® qPCR Master Mix (2000 reactions)

Sign In for Pricing
View Details
OGDHL (NM_001143997) Human Over-expression Lysate
LY428457 100 µg

OGDHL (NM_001143997) Human Over-expression Lysate

Sign In for Pricing
View Details
Zalcitabine-13C,15N2
TRC-Z140002-50MG 50 mg

Zalcitabine-13C,15N2

Sign In for Pricing
View Details
DNAJB9 (NM_012328) Human Over-expression Lysate
LY402196 100 µg

DNAJB9 (NM_012328) Human Over-expression Lysate

Sign In for Pricing
View Details
Cdk1 / p34cdc2 Serine-Threonine Kinase (A17.1.1), CF640R conjugate, 0.1mg/mL
BNC401083-500 1x 500 µL

Cdk1 / p34cdc2 Serine-Threonine Kinase (A17.1.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details