Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant HIV-1 gp41 Long (444-833 a.a.)

Source : Escherichia Coli. The E.Coli derived protein contains the full-length sequence of N-terminal epitopes of HIV-I gp41 395 amino acids (444-833) immunodominant regions gp41L. The protein is fused to b-galactosidase (114 kDa) at N-Terminus. Human immunodeficiency virus (HIV) is a retrovirusthat can lead to a condition in which the immune systembegins to fail, leading to opportunistic infections. HIV primarily infects vital cells in the humanimmune systemsuch as helper T cells (specifically CD4+ T cells), macrophagesand dendritic cells. HIV infection leads to low levels of CD4+ T cells through three main mechanisms: firstly, direct viral killing of infected cells; secondly, increased rates of apoptosisin infected cells; and thirdly, killing of infected CD4+ T cells by CD8 cytotoxic lymphocytesthat recognize infected cells. When CD4+ T cell numbers decline below a critical level, cell-mediated immunityis lost, and the body becomes progressively more susceptible to opportunistic infections. HIV was classified as a member of the genus Lentivirus, part of the family of Retroviridae. Lentiviruses have many common morphologies and biological properties. Many species are infected by lentiviruses, which are characteristically responsible for long-duration illnesses with a long incubation period. Lentiviruses are transmitted as single-stranded, positive-sense, enveloped RNA viruses. Upon entry of the target cell, the viral RNA genomeis converted to double-stranded DNAby a virally encoded reverse transcriptasethat is present in the virus particle. This viral DNA is then integrated into the cellular DNA by a virally encoded integraseso that the genome can be transcribed. Once the virus has infected the cell, two pathways are possible: either the virus becomes latentand the infected cell continues to function, or the virus becomes active and replicates, and a large number of virus particles are liberated that can then infect other cells.

Product Specifications

Purification

Greater than 95.0% as determined by HPLC analysis & SDS-PAGE.

Components

8M Urea, 20mM Tris-HCl pH 8.0, 10mM Beta-mercaptoethanol.

Storage Conditions

HIV-1 gp41 Long although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.

Amino Acids

IEFPGIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTKAKRRVVQ REKRAVGIGALFLG

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Igsf1 (NM_177915) Mouse Tagged ORF Clone Lentiviral Particle
MR223356L4V 200 µL

Igsf1 (NM_177915) Mouse Tagged ORF Clone Lentiviral Particle

Ask
View Details
Slc38a7 AAV siRNA Pooled Vector
44174164 1.0 µg

Slc38a7 AAV siRNA Pooled Vector

Ask
View Details
MacConkey HiVeg® Agar w/o CV, w/
0.003% NR and 1.5% Agar
MV008-100G 100 g

MacConkey HiVeg® Agar w/o CV, w/
0.003% NR and 1.5% Agar

Ask
View Details
Nfe2 (NM_001302341) Mouse Tagged ORF Clone
MR229554 10 µg

Nfe2 (NM_001302341) Mouse Tagged ORF Clone

Ask
View Details
Cytochrome P450 1A2 (CYP1A2) Mouse Monoclonal Antibody [Clone ID: OTI1E12]
TA501172 100 µL

Cytochrome P450 1A2 (CYP1A2) Mouse Monoclonal Antibody [Clone ID: OTI1E12]

Ask
View Details