Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B Surface Antigen preS2

Source : E.coli. The Recombinant Hepatitis B Surface Antigen preS2 is approximately 5.7 kDa, a single non-glycosylated polypeptide chain containing 55 amino acids. Purified by proprietary chromatographic technique. Hepatitis B virus (HBV) is a human pathogen, causing serious liver disease. The HBV surface protein antigens (HBsAg) are comprised of three carboxyl co terminal HBs proteins termed large (LHBs), middle (MHBs) and small (SHBs, also called major) protein. LHBs and MHBs also share the highly hydrophobic, repetitive, membrane spanning S domain. In addition, MHBs has a 55 amino acid region called preS2.

Product Specifications

Purification

HBsAg protein is >95% pure as determined by 10% PAGE (coomassie staining) .

Components

HBsAg protein was lyophilized from 0.2μm filtered (1mg/mL) solution in 20mM PB, pH 7.4 and 50mM NaCl.

Storage Conditions

This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at

Amino Acids

MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASP ISSIFSRTGDPAPN.

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Anti-CAR/CXADR Polyclonal Antibody
PAV5469 100 μL

Rabbit Anti-CAR/CXADR Polyclonal Antibody

Ask
View Details
Recombinant Zebrafish Nuclear Factor Kappa B (NFkB)
RPU59966-01 50 µg

Recombinant Zebrafish Nuclear Factor Kappa B (NFkB)

Ask
View Details
Recombinant Zebrafish Nuclear Factor Kappa B (NFkB)
RPU59966-02 100 µg

Recombinant Zebrafish Nuclear Factor Kappa B (NFkB)

Ask
View Details
Recombinant Zebrafish Nuclear Factor Kappa B (NFkB)
RPU59966-03 1 mg

Recombinant Zebrafish Nuclear Factor Kappa B (NFkB)

Ask
View Details
Mouse Monoclonal Thymidylate Synthase Antibody (TYMS/1884) [FITC]
NBP3-08882F 100 µL

Mouse Monoclonal Thymidylate Synthase Antibody (TYMS/1884) [FITC]

Ask
View Details
Fish Nicotinamide Mononucleotide Adenylyltransferase 2 (NMNAT2) ELISA Kit
MBS9399458 Inquire

Fish Nicotinamide Mononucleotide Adenylyltransferase 2 (NMNAT2) ELISA Kit

Ask
View Details