Recombinant Hepatitis B Surface Antigen preS1
Source : The E.Coli derived Recombinant Hepatitis B Surface Antigen preS1 is a single non-glycosylated polypeptide chain containing 119 amino acids and having a molecular weight of 12.6 kDa. Hepatitis B virus (HBV) is a human pathogen, causing serious liver disease. The HBV surface protein antigens (HBsAg) are comprised of three carboxyl co terminal HBs proteins termed large (LHBs), middle (MHBs) and small (SHBs, also called major) protein. LHBs and MHBs also share the highly hydrophobic, repetitive, membrane spanning S domain. In addition, LHBs has a 119 amino acid region called preS1.
Product Specifications
Purification
HBsAg Protein is >95% pure as determined by 10% PAGE (coomassie staining) .
Components
HBsAg protein was lyophilized from 0.2μm filtered (1mg/mL) solution in 20mM PB, pH 7.4, and 50mM NaCl.
Storage Conditions
Applications Notes
Amino Acids
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEAHQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQA.
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items