Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B Surface Antigen preS1

Source : The E.Coli derived Recombinant Hepatitis B Surface Antigen preS1 is a single non-glycosylated polypeptide chain containing 119 amino acids and having a molecular weight of 12.6 kDa. Hepatitis B virus (HBV) is a human pathogen, causing serious liver disease. The HBV surface protein antigens (HBsAg) are comprised of three carboxyl co terminal HBs proteins termed large (LHBs), middle (MHBs) and small (SHBs, also called major) protein. LHBs and MHBs also share the highly hydrophobic, repetitive, membrane spanning S domain. In addition, LHBs has a 119 amino acid region called preS1.

Product Specifications

Purification

HBsAg Protein is >95% pure as determined by 10% PAGE (coomassie staining) .

Components

HBsAg protein was lyophilized from 0.2μm filtered (1mg/mL) solution in 20mM PB, pH 7.4, and 50mM NaCl.

Storage Conditions

This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at

Amino Acids

MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEAHQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQA.

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Bovine Monoamine oxidase (MAO) ELISA Kit
NSL0564Bo 96 Tests

Bovine Monoamine oxidase (MAO) ELISA Kit

Ask
View Details
CASQ1 Rabbit Polyclonal Antibody
TA365577 100 µL

CASQ1 Rabbit Polyclonal Antibody

Ask
View Details
Mouse Polyclonal FOXD4 Antibody
H00002298-B01P 0.05 mg

Mouse Polyclonal FOXD4 Antibody

Ask
View Details
Human CDRT15 activation kit by CRISPRa
GA115580 1 Kit

Human CDRT15 activation kit by CRISPRa

Ask
View Details
Mouse SNX27 shRNA Plasmid
abx978672-01 150 µg

Mouse SNX27 shRNA Plasmid

Ask
View Details
Mouse SNX27 shRNA Plasmid
abx978672-02 300 µg

Mouse SNX27 shRNA Plasmid

Ask
View Details