Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Herpes Simplex Virus-2 gB

Source : Escherichia Coli. The E.Coli derived HSV-2 gB recombinant protein is fused to a Six histidine tag at C-terminus and has a MW of 82kDa (pI 8.35) . Entry of HSV into the host cell involves interactions of several viral glycoproteins with cell surface receptors. The virus particle is covered by an envelope which, when bound to specific receptors on the cell surface, will fuse with the cell membrane and create an opening, or pore, through which the virus enters the host cell. The sequential stages of HSV entry are analagous to those of other viruses. At first, complementary receptors on the virus and cell surface bring the two membranes into proximity. In an intermediate state, the two membranes begin to merge, forming a hemifusion state. Finally, a stable entry pore is formed through which the viral envelope contents are introduced to the host cell.

Product Specifications

Purification

Protein is >90% pure as determined by SDS PAGE.

Components

10mM Phosphate buffer pH 7.6 and 75mM NaCl.

Storage Conditions

HSV-2 gB although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.

Amino Acids

MIAPYKFKATMYYKDVTVSQVWFGHRYSQFMGIFEDRAPVPFEEVIDKINAKGVCRST AKYVRNNLETTAFHRDDHETDMELKPANAATRTSRGWHTTDLKYNPSRVEAFHRYGTTVNCIVEEVDARSVYPYDEFVLATGDFVYMSPFYGYREGSHTEHTSYAADRFKQVDGFYARDLTTKARATAPTTRNLLTTPKFTVAWDWVPKRPSVCTHHHHHH.
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal to Human KISS1R / GPR54
MBS242902-01 0.05 mg

Rabbit Polyclonal to Human KISS1R / GPR54

Ask
View Details
Rabbit Polyclonal to Human KISS1R / GPR54
MBS242902-02 5x 0.05 mg

Rabbit Polyclonal to Human KISS1R / GPR54

Ask
View Details
Mouse Aifm3 Pre-designed siRNA Set B
SI100445B 1 Each

Mouse Aifm3 Pre-designed siRNA Set B

Ask
View Details
LETM1 siRNA (Mouse)
CRM5765-01 15 nmol

LETM1 siRNA (Mouse)

Ask
View Details
LETM1 siRNA (Mouse)
CRM5765-02 30 nmol

LETM1 siRNA (Mouse)

Ask
View Details
BRD7 Rabbit pAb
MBS9146432-01 0.02 mL

BRD7 Rabbit pAb

Ask
View Details