Recombinant Der P1 Protein
Source : Escherichia Coli. The E.Coli derived recombinant protein contains the Dermatophagoides pteronyssinus Dust Mite Der P1 protein (a.a. 20-320) and fused to a 6 His Tag at C-terminus, having a total Mw of 34.8kDa, pI 5.8. DERP1 is a thiol protease, with a preference for substrates with a large hydrophobic side chain in the P2 position, or with basic residues. DERP1 is a C1 peptidase family member. DERP1 has extensive endopeptidase specificity. DERP1 is N-glycosylated. N-glycanase treatment does not completely remove carbohydrates, suggesting that the protein contains additional glycosylation sites. DERP1 causes an allergic reaction in humans. Common symptoms of mite allergy are bronchial asthma, allergic rhinitis and conjunctivitis. DERP1 binds to IgE in 80% of patients with house dust allergy.
Product Specifications
Product Name Alternative
Peptidase 1||Major mite fecal allergen Der p 1||Allergen Der p I||Der p 1||DERP1||Der-P1.
Purification
Protein is >95% pure as determined by 10% SDS-PAGE (coomassie staining) .
Components
(1mg/mL) 60mM NaCl, 50mM Tris-HCl pH 8.0 and 1.2M Urea.
Storage Conditions
Der-P1 although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
Amino Acids
MSIKTFEEYKKAFNKSYATFEDEEAARKNFLESVKYVQSNGGAINHLSDLSLDEFK
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
Lentiviral human WIPF1 shRNA (UAS) - Lentiviral human WIPF1 shRNA (UAS, RFP) (100)
