Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptavidin

Source : Escherichia Coli. Streptavidin Streptomyces Avidinii Recombinant produced in E.Coli. The molecular weight per tetramer is approximately 52kDa. Streptavidin is a tetrameric protein secreted by Streptomyces avidinii which binds firmly to biotin. Streptavidin is widely used in molecular biology through its unique high affinity for the vitamin biotin. The dissociation constant (Kd) of the biotin-streptavidin complex is about ~10-15 mol/L. The strong affinity recognition of biotin and biotinylated molecules has made streptavidin one of the most important components in diagnostics and laboratory kits. The streptavidin/biotin system has one of the biggest free energies of association of yet observed for noncovalent binding of a protein and small ligand in aqueous solution (K_assoc = 10**14) . The complexes are also extremely stable over a wide range of temperature and pH.

Product Specifications

Purification

Greater than 98.0% as determined by SDS-PAGE and HPLC.

Components

Lyophilized in 10mM potassium phosphate buffer pH 6.5.

Storage Conditions

Streptavidin is shipped at ambient temperature, upon arrival store at -20°C.

Applications Notes

It is recommended to reconstitute the lyophilized Streptavidin in sterile 18M-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.

Amino Acids

MAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAAS.

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse TPBG / 5T4 Protein, His Tag (MALS verified)
TPG-M52H3-100ug 100 µg

Mouse TPBG / 5T4 Protein, His Tag (MALS verified)

Ask
View Details
Flavanomarein
HY-N7675-01 5 mg

Flavanomarein

Ask
View Details
Flavanomarein
HY-N7675-02 10 mg

Flavanomarein

Ask
View Details
Mtb against-1
MF-0113736-01 10 mg

Mtb against-1

Ask
View Details
Mtb against-1
MF-0113736-02 50 mg

Mtb against-1

Ask
View Details
Rat TLR4 (Toll-like receptor 4) ELISA Kit
ER0363 96 Tests

Rat TLR4 (Toll-like receptor 4) ELISA Kit

Ask
View Details