Recombinant Human Ras-Related C3 Botulinum Toxin substrate 1

Source : Escherichia Coli. Ras-Related C3 Botulinum Toxin substrate 1 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 192 amino acids and having a molecular mass of 21.4 kDa. RAC1 is a GTPase which belongs to the RAS superfamily of small GTP-binding proteins. Members of this superfamily appear to regulate a diverse array of cellular events, including the control of cell growth, cytoskeletal reorganization, and the activation of protein kinases. RAC-1 regulates the actin cytoskeleton but also other cellular processes. RAC1 have been shown to be involved in the regulation of cell-cell adhesion.

Product Specifications

Product Name Alternative

P21-RAC1||RAC-1||RAC1||RAS-like protein TC25||MIG5||Cell-migration-inducing gene 5 protein, Ras-related C3 botulinum toxin substrate 1||rho family small GTP binding protein Rac1||TC-25||MGC111543.

Purification

Greater than 95.0% as determined by SDS-PAGE.

Components

The protein solution contains 20mM Tris-HCl pH7.5, 2mM EDTA and 1mM DTT.

Storage Conditions

Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Avoid multiple freeze-thaw cycles.

Amino Acids

MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCP PPVKKRKRKCLLL.