Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Helicobacter Pylori Outer Membrane Protein

Source : E.Coli Omp Pylori recombinant antigen is produced in E. coli expressing the H. pylori outer membrane protein having the Mw of 23 kDa. Omp Pylori recombinant antigen is well recognized by specific IgG and IgM from H. pylori infected patients. Helicobacter pylori, a Gram-negative, microaerophilic bacterium that populates in the stomach, predominantly at the antrum. Helicobacter pylori causes a chronic inflammation of the mucoid lining of stomach and is highly related to the growth of duodenal and gastric ulcers and stomach cancer. Over 50% of the world's population harbor H. pylori in their upper gastrointestinal tract, infection is more prevalent in developing countries. Thus far, no ideal target H. pylori antigen has been developed for the diagnostic purpose. 23 kDa H. pylori outer membrane protein was identified with a good sensitivity and coverage in the diagnosis of H. pylori infection.

Product Specifications

Purification

Greater than 95% pure as determined by 12% PAGE (Coomassie staining) .

Components

The Omp Pylori recombinant protein is formulated in 1xPBS pH 7.4.

Storage Conditions

Omp Pylori although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.

Amino Acids

MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKNGAILFFWPKDFTFVCPTEIIAFDKRVKDFQEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMVDALLHFEEHGEVCPAGWRKGDKGMKATHQGVAEYLKENSIKL.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal PTGFRN Antibody
NBP1-85762 0.1 mL

Rabbit Polyclonal PTGFRN Antibody

Sign In for Pricing
View Details
Ferric Oxide Red (Iron Oxide Red)
106060 500 500 g

Ferric Oxide Red (Iron Oxide Red)

Sign In for Pricing
View Details
Sp1 Transcription Factor (TFSP1) discontinued
S5369-95E 100 µg

Sp1 Transcription Factor (TFSP1) discontinued

Sign In for Pricing
View Details
Recombinant Yersinia pseudotuberculosis serotype IB Uncharacterized Nudix hydrolase NudL (nudL)
MBS1177195-01 0.02 mg (E-Coli)

Recombinant Yersinia pseudotuberculosis serotype IB Uncharacterized Nudix hydrolase NudL (nudL)

Sign In for Pricing
View Details
Recombinant Yersinia pseudotuberculosis serotype IB Uncharacterized Nudix hydrolase NudL (nudL)
MBS1177195-02 0.1 mg (E-Coli)

Recombinant Yersinia pseudotuberculosis serotype IB Uncharacterized Nudix hydrolase NudL (nudL)

Sign In for Pricing
View Details
Recombinant Yersinia pseudotuberculosis serotype IB Uncharacterized Nudix hydrolase NudL (nudL)
MBS1177195-03 0.02 mg (Yeast)

Recombinant Yersinia pseudotuberculosis serotype IB Uncharacterized Nudix hydrolase NudL (nudL)

Sign In for Pricing
View Details