Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Helicobacter Pylori Outer Membrane Protein

Source : E.Coli Omp Pylori recombinant antigen is produced in E. coli expressing the H. pylori outer membrane protein having the Mw of 23 kDa. Omp Pylori recombinant antigen is well recognized by specific IgG and IgM from H. pylori infected patients. Helicobacter pylori, a Gram-negative, microaerophilic bacterium that populates in the stomach, predominantly at the antrum. Helicobacter pylori causes a chronic inflammation of the mucoid lining of stomach and is highly related to the growth of duodenal and gastric ulcers and stomach cancer. Over 50% of the world's population harbor H. pylori in their upper gastrointestinal tract, infection is more prevalent in developing countries. Thus far, no ideal target H. pylori antigen has been developed for the diagnostic purpose. 23 kDa H. pylori outer membrane protein was identified with a good sensitivity and coverage in the diagnosis of H. pylori infection.

Product Specifications

Purification

Greater than 95% pure as determined by 12% PAGE (Coomassie staining) .

Components

The Omp Pylori recombinant protein is formulated in 1xPBS pH 7.4.

Storage Conditions

Omp Pylori although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.

Amino Acids

MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKNGAILFFWPKDFTFVCPTEIIAFDKRVKDFQEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMVDALLHFEEHGEVCPAGWRKGDKGMKATHQGVAEYLKENSIKL.
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit anti-Mus musculus (Mouse) Rnf130 Polyclonal Antibody
MBS9004407 Inquire

Rabbit anti-Mus musculus (Mouse) Rnf130 Polyclonal Antibody

Ask
View Details
Mouse Monoclonal DCXR Antibody (OTI7D11) [Alexa Fluor 700]
NBP2-71906AF700 0.1 mL

Mouse Monoclonal DCXR Antibody (OTI7D11) [Alexa Fluor 700]

Ask
View Details
Mouse Slc28a3 (NM_022317) AAV Particle
MR210144A1V 250 µL

Mouse Slc28a3 (NM_022317) AAV Particle

Ask
View Details
VWA2 AAV siRNA Pooled Vector
50234161 1.0 µg

VWA2 AAV siRNA Pooled Vector

Ask
View Details
5-Acetamido-2-chlorophenol
434780-01 100 mg

5-Acetamido-2-chlorophenol

Ask
View Details
5-Acetamido-2-chlorophenol
434780-02 250 mg

5-Acetamido-2-chlorophenol

Ask
View Details