Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Helicobacter Pylori Outer Membrane Protein

Source : E.Coli Omp Pylori recombinant antigen is produced in E. coli expressing the H. pylori outer membrane protein having the Mw of 23 kDa. Omp Pylori recombinant antigen is well recognized by specific IgG and IgM from H. pylori infected patients. Helicobacter pylori, a Gram-negative, microaerophilic bacterium that populates in the stomach, predominantly at the antrum. Helicobacter pylori causes a chronic inflammation of the mucoid lining of stomach and is highly related to the growth of duodenal and gastric ulcers and stomach cancer. Over 50% of the world's population harbor H. pylori in their upper gastrointestinal tract, infection is more prevalent in developing countries. Thus far, no ideal target H. pylori antigen has been developed for the diagnostic purpose. 23 kDa H. pylori outer membrane protein was identified with a good sensitivity and coverage in the diagnosis of H. pylori infection.

Product Specifications

Purification

Greater than 95% pure as determined by 12% PAGE (Coomassie staining) .

Components

The Omp Pylori recombinant protein is formulated in 1xPBS pH 7.4.

Storage Conditions

Omp Pylori although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.

Amino Acids

MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKNGAILFFWPKDFTFVCPTEIIAFDKRVKDFQEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMVDALLHFEEHGEVCPAGWRKGDKGMKATHQGVAEYLKENSIKL.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse MyD88 protein, N-His Tag
IMP-4058 10 µg

Recombinant Mouse MyD88 protein, N-His Tag

Sign In for Pricing
View Details
Complement Factor D (CFD) Porcine ELISA Kit
C3054 96 Tests

Complement Factor D (CFD) Porcine ELISA Kit

Sign In for Pricing
View Details
Coagulation Factor II (F2) Recombinant, Mouse
154048-01 10 µg

Coagulation Factor II (F2) Recombinant, Mouse

Sign In for Pricing
View Details
Coagulation Factor II (F2) Recombinant, Mouse
154048-02 50 µg

Coagulation Factor II (F2) Recombinant, Mouse

Sign In for Pricing
View Details
Coagulation Factor II (F2) Recombinant, Mouse
154048-03 200 µg

Coagulation Factor II (F2) Recombinant, Mouse

Sign In for Pricing
View Details
LY 2389575 Hydrochloride
454000-01 1 mg

LY 2389575 Hydrochloride

Sign In for Pricing
View Details