Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Myelin Oligodendrocyte Glycoprotein

Source : Escherichia Coli. Myelin Oligodendrocyte Glycoprotein produced in E.Coli is a single, non-glycosylated polypeptide chain containing a total of 132 amino acids (Met + 30-154 a.a. + 6x His tag at C-terminus) and having a total molecular mass of 15.2 kDa. Myelin Oligodendrocyte Glycoprotein is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a prime target antigen that plays a role in immune-mediated demyelination. Myelin Oligodendrocyte Glycoprotein is involved in completion and maintenance of the myelin sheath and in cell-cell communication. MOG protein was found to differentially expressed in the dorsolateral prefrontal cortex and in the temporal lobe from patients with schizophrenia. MOG-specific antibody is crucial to the initiation of MOG-induced murine experimental autoimmune encephalomyelitis.

Product Specifications

Product Name Alternative

Myelin Oligodendrocyte Glycoprotein||MOG||MOGIG-2||MGC26137.

Purification

Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Components

The Myelin Oligodendrocyte Glycoprotein 0.5mg/mL solution was lyophilized from 20mM sodium acetate buffer pH-4 and 0.3M sodium chloride.

Storage Conditions

Lyophilized MOG although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MOG should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles.

Applications Notes

It is recommended to reconstitute the lyophilized MOG in sterile 10mM Acetic acid not less than 100μg/ml, which can then be further diluted to other aqueous solutions.

Amino Acids

MGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGHHHHHH.

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

FOXJ1 Rabbit mAb
MBS4764104-01 0.1 mL

FOXJ1 Rabbit mAb

Ask
View Details
FOXJ1 Rabbit mAb
MBS4764104-02 5x 0.1 mL

FOXJ1 Rabbit mAb

Ask
View Details
Plant Leucine Aminopepridase (LAP) ELISA Kit
MBS9378272 Inquire

Plant Leucine Aminopepridase (LAP) ELISA Kit

Ask
View Details
Flumazenil 50mg
A10397-50 50 mg

Flumazenil 50mg

Ask
View Details
Recombinant Yersinia pestis bv. Antiqua Crossover junction endodeoxyribonuclease RuvC (ruvC)
MBS1167466-01 0.02 mg (E-Coli)

Recombinant Yersinia pestis bv. Antiqua Crossover junction endodeoxyribonuclease RuvC (ruvC)

Ask
View Details
Recombinant Yersinia pestis bv. Antiqua Crossover junction endodeoxyribonuclease RuvC (ruvC)
MBS1167466-02 0.1 mg (E-Coli)

Recombinant Yersinia pestis bv. Antiqua Crossover junction endodeoxyribonuclease RuvC (ruvC)

Ask
View Details