Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ICAM1 HEK Recombinant Protein

Source : HEK293 cells. ICAM1 Human Recombinant produced by mammalian expression system in human cells is a single polypeptide chain containing 461 amino acids (28-480) . ICAM1 is fused to an 8 amino acid His-tag at C-terminus & purified by proprietary chromatographic techniques. ICAM-1 also called CD54 is a single chain membrane glycoprotein expressed on the surface of a variety of non-haematopoietic and haematopoietic cell types and has roles in signal transduction, cell signaling and lymphocyte adhesion. ICAM1 binds to integrins such as CD11a / CD18, or CD11b / CD18. ICAM1 is also used by Rhinovirus as a receptor. ICAM-1 is an intercellular adhesion molecule constantly present in low concentrations in the membranes of leukocytes and endothelial cells. When stimulated by cytokine the concentrations significantly increase. ICAM-1 can be stimulated by interleukin-1 (IL-1) and tumor necrosis factor alpha (TNFA) and is expressed by the vascular endothelium, macrophages and lymphocytes. ICAM-1 is a ligand for LFA-1 which is a receptor found on leukocytes. Upon activation, leukocytes bind to endothelial cells via ICAM-1/LFA-1 and then transmigrate into tissues.ICAM-1 is implicated in subarachnoid hemorrhage (SAH) . Levels of ICAM-1 are shown to be notably elevated in patients with SAH. Soluble ICAM-1 is detectable in the plasma and is elevated in patients with various inflammatory conditions.

Product Specifications

Product Name Alternative

Intercellular adhesion molecule 1||ICAM-1||Major group rhinovirus receptor||CD54 antigen||ICAM1||BB2||CD54||P3.58.

Purification

Greater than 95% as determined by SDS-PAGE.

Components

ICAM1 was lyophilized from a 0.2 mM filtered solution of 20mM PB and 150mM NaCl, pH 7.2.

Storage Conditions

Lyophilized ICAM1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution ICAM1 should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.

Applications Notes

It is recommended to reconstitute the lyophilized ICAM1 in 1xPBS to a concentration no less than 100 μg/ml, which can then be further diluted to other aqueous solutions.

Amino Acids

TTPQTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYEVDHHHHHH.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Butanilicaine Hydrochloride
TRC-B693055-50MG 50 mg

Butanilicaine Hydrochloride

Sign In for Pricing
View Details
FAM40A (STRIP1) (NM_033088) Human Recombinant Protein
TP310537M 100 µg

FAM40A (STRIP1) (NM_033088) Human Recombinant Protein

Sign In for Pricing
View Details
GAD1 / GAD67 (GABAergic Neuronal Marker) (GAD1/2563), CF647 conjugate, 0.1mg/mL
BNC472563-100 1x 100 µL

GAD1 / GAD67 (GABAergic Neuronal Marker) (GAD1/2563), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Mouse TFPI2 Protein (Fc Tag)
PKSM040393 50 µg

Recombinant Mouse TFPI2 Protein (Fc Tag)

Sign In for Pricing
View Details
TAS1R2 (C-term) Rabbit Polyclonal Antibody
AP54154PU-N 400 µL

TAS1R2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NPTX1 (NM_002522) Human Recombinant Protein
TP701040 50 µg

NPTX1 (NM_002522) Human Recombinant Protein

Sign In for Pricing
View Details