Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ICAM1 HEK Recombinant Protein

Source : HEK293 cells. ICAM1 Human Recombinant produced by mammalian expression system in human cells is a single polypeptide chain containing 461 amino acids (28-480) . ICAM1 is fused to an 8 amino acid His-tag at C-terminus & purified by proprietary chromatographic techniques. ICAM-1 also called CD54 is a single chain membrane glycoprotein expressed on the surface of a variety of non-haematopoietic and haematopoietic cell types and has roles in signal transduction, cell signaling and lymphocyte adhesion. ICAM1 binds to integrins such as CD11a / CD18, or CD11b / CD18. ICAM1 is also used by Rhinovirus as a receptor. ICAM-1 is an intercellular adhesion molecule constantly present in low concentrations in the membranes of leukocytes and endothelial cells. When stimulated by cytokine the concentrations significantly increase. ICAM-1 can be stimulated by interleukin-1 (IL-1) and tumor necrosis factor alpha (TNFA) and is expressed by the vascular endothelium, macrophages and lymphocytes. ICAM-1 is a ligand for LFA-1 which is a receptor found on leukocytes. Upon activation, leukocytes bind to endothelial cells via ICAM-1/LFA-1 and then transmigrate into tissues.ICAM-1 is implicated in subarachnoid hemorrhage (SAH) . Levels of ICAM-1 are shown to be notably elevated in patients with SAH. Soluble ICAM-1 is detectable in the plasma and is elevated in patients with various inflammatory conditions.

Product Specifications

Product Name Alternative

Intercellular adhesion molecule 1||ICAM-1||Major group rhinovirus receptor||CD54 antigen||ICAM1||BB2||CD54||P3.58.

Purification

Greater than 95% as determined by SDS-PAGE.

Components

ICAM1 was lyophilized from a 0.2 mM filtered solution of 20mM PB and 150mM NaCl, pH 7.2.

Storage Conditions

Lyophilized ICAM1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution ICAM1 should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.

Applications Notes

It is recommended to reconstitute the lyophilized ICAM1 in 1xPBS to a concentration no less than 100 μg/ml, which can then be further diluted to other aqueous solutions.

Amino Acids

TTPQTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYEVDHHHHHH.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vimentin (VM452), CF740 conjugate, 0.1mg/mL
BNC740452-100 1x 100 µL

Vimentin (VM452), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Rat CADM3 Protein (Fc Tag)
PKSR030311 100 µg

Recombinant Rat CADM3 Protein (Fc Tag)

Sign In for Pricing
View Details
Rnls Mouse Gene Knockout Kit (CRISPR)
KN514966 1 Kit

Rnls Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PAK4 (NM_001014831) Human Over-expression Lysate
LY423086 100 µg

PAK4 (NM_001014831) Human Over-expression Lysate

Sign In for Pricing
View Details
CD9 (TSPAN29) (Motility-Related Protein-1) (CD9/1619), Biotin conjugate, 0.1mg/mL
BNCB1619-100 1x 100 µL

CD9 (TSPAN29) (Motility-Related Protein-1) (CD9/1619), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
5-Bromovaleronitrile
TRC-B699498-2.5G 2.5 g

5-Bromovaleronitrile

Sign In for Pricing
View Details