Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD14 HEK Recombinant Protein

Source : HEK293 cells. CD14 Human Recombinant produced by mammalian expression system in human cells is a single polypeptide chain containing 341 amino acids (20-352) . CD14 is fused to an 8 amino acid His-tag at C-terminus & purified by proprietary chromatographic techniques. CD14 (also known lipopolysaccharide (LPS) receptor) is expressed strongly on monocytes and macrophage and weakly on the surface of neutrophils. CD14 is anchored to cells by linkage to glycosylphosphatidylinositol (GPI) and functions as a high affinity receptor for complexes of LPS and LPS binding protein (LBP) . Soluble CD14, also binding to LPS, acts at physiological concentration as an LPS agonist and has, at higher concentrations, an LPS antagonizing effect in cell activation. CD14 has been shown to bind apoptotic cells.

Product Specifications

Product Name Alternative

Monocyte differentiation antigen CD14||Myeloid cell-specific leucine-rich glycoprotein||CD14.

Purification

Greater than 95% as determined by SDS-PAGE.

Components

CD14 was lyophilized from a 0.2 mM filtered solution of 20mM PB and 150mM NaCl, PH 7.4.

Storage Conditions

Lyophilized CD14 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CD14 should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.

Applications Notes

It is recommended to reconstitute the lyophilized CD14 in 1xPBS to a concentration no less than 100 μg/ml, which can then be further diluted to other aqueous solutions.

Amino Acids

TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACVDHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PECR Antibody
KC-19626-01 50 μL

PECR Antibody

Sign In for Pricing
View Details
PECR Antibody
KC-19626-02 100 µL

PECR Antibody

Sign In for Pricing
View Details
PECR Antibody
KC-19626-03 1 mL

PECR Antibody

Sign In for Pricing
View Details
N-Acetyl-D-[15N]mannosamine
TRC-A186205-1MG 1 mg

N-Acetyl-D-[15N]mannosamine

Sign In for Pricing
View Details
4-Aminohippuric-d4 Acid
TRC-A627972-25MG 25 mg

4-Aminohippuric-d4 Acid

Sign In for Pricing
View Details
Furagin-13C3
TRC-F863002-5MG 5 mg

Furagin-13C3

Sign In for Pricing
View Details