AHSG HEK Recombinant Protein

Source : HEK293 cells. AHSG Human Recombinant produced by transfected human cells is a single polypeptide chain containing 357 amino acids (19-367) . AHSG is fused to an 8 amino acid His-tag at C-terminus & purified by proprietary chromatographic techniques. Fetuin is a liver-produced negative acute phase protein composed of two subunits, the A and B chains.Fetuin homologs have been identified in several species including rat, sheep, pig, rabbit, guinea pig, cattle, mouse and human. Multiple physiological roles for these homologs have been suggested, including ability to bind to hydroxyapatite crystals and to specifically inhibit the tyrosine kinase (TK) activity of the insulin receptor (IR) .Fetuin-A (alpha2-Heremans-Schmid glycoprotein; AHSG) is an important circulating inhibitor of calcification in vivo, and is downregulated during the acute-phase response.Sera from patients on long-term dialysis with low AHSG concentrations showed impaired ex-vivo capacity to inhibit CaxPO4 precipitation.Fetuin may influence the resolution of inflammation by modulating the phagocytosis of apoptotic cells by macrophages.ASHG blocks TGF-beta-dependent signaling in osteoblastic cells, and mice lacking ASHG display growth plate defects, increased bone formation with age, and enhanced cytokine-dependent osteogenesis.

Product Specifications

Product Name Alternative

Alpha-2-HS-glycoprotein||Fetuin-A||Alpha-2-Z-globulin||Ba-alpha-2-glycoprotein||AHSG||FETUA||AHS||A2HS||HSGA||PRO2743.

Purification

Greater than 95% as determined by SDS-PAGE.

Components

AHSG was lyophilized from a 0.2 mM filtered solution of 20mM PB and 150mM NaCl, pH 7.5.

Storage Conditions

Lyophilized AHSG although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution AHSG should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.

Applications Notes

It is recommended to reconstitute the lyophilized AHSG in 1xPBS to a concentration no less than 100 μg/ml, which can then be further diluted to other aqueous solutions.

Amino Acids

APHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQTQPVTSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAAAGPVVPPCPGRIRHFKVVDHHHHHH.