Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ag85B Recombinant Protein

Source : Escherichia Coli. Ag85B Recombinant His-Tag fusion protein produced in E.Coli is a single, non-glycosylated polypeptide chain having a molecular mass of 30kDa. Antigen 85B Mycobacterium Tuberculosis-is the most abundant protein exposed by M. Tuberculosis, as well as a potent immunoprotective antigen and a leading drug target. Ag85 induces strong T-cell proliferation and IFN-g secretion in most healthy individuals exposed to M. tuberculosis, in BCG-vaccinated mice and humans, whereas the antibody against Ag85 are more prevalent in active tuberculosis patients with decreased cellular immune response.

Product Specifications

Product Name Alternative

Antigen 85-B||85B||Extracellular alpha-antigen||Antigen 85 complex B||Ag85B||Mycolyl transferase 85B||EC 2.3.1.-||Fibronectin-binding protein B||30 kDa extracellular protein||fbpB||A85B||Major Secretory Protein Antigen 85B.

Purification

Greater than 90.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Components

Lyophilized with 0.1% glycerol.

Storage Conditions

Ag85B although stable room temperature for 4 weeks, should be stored desiccated below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles.

Applications Notes

It is recommended to reconstitute the lyophilized Antigen-85B in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.

Amino Acids

MRGSHHHHHHFSRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAG.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sp3/4
335250-01 50 µg

Sp3/4

Sign In for Pricing
View Details
Sp3/4
335250-02 100 µg

Sp3/4

Sign In for Pricing
View Details
anti-Endothelin 1
YF-PA11487 50 ug

anti-Endothelin 1

Sign In for Pricing
View Details
Hsa-miR-1207-3p miRNA Inhibitor
orb1872759-01 10 nmol

Hsa-miR-1207-3p miRNA Inhibitor

Sign In for Pricing
View Details
Hsa-miR-1207-3p miRNA Inhibitor
orb1872759-02 20 nmol

Hsa-miR-1207-3p miRNA Inhibitor

Sign In for Pricing
View Details
Benzalkonium chloride
C11195-25mg 25 mg

Benzalkonium chloride

Sign In for Pricing
View Details