Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FKBP1A Recombinant Protein

Source : Escherichia Coli. FKPB1A Human Recombinant fused to N-terminal His-Tag produced in E.Coli is a single, non-glycosylated polypeptide chain purified through a Ni2+-affinity chromatography followed by gel filtration. FKBP1A is a 12kDa protein initialy discovered onin immune cells on the basis of its capability to bind and mediate the intracellular effect of the immunosuppressant FK506. FKBP1A is also known to mediate the action of Rapamycin-immunosuppressive agent. FKBP1A is part of the family of immunophilins, which have in common high affinity for immunosuppressant drugs and a peptidyl-prolyl cis-trans isomerase (PPIase) . Activity which participates in folding of proline-containing protein. In the absence of immunosuppressive ligands, FKBP1A is involved in intracellular calcium regulation by associating with 3 types of Ca2+ release channel complexes: skeletal ryanodine receptors, cardiac ryanodine receptors and the inositol 1,4,5-triphosphate receptor. FKBP1A also interact with TGF-b type I receptor exerting an inhibitory effect on the TGF-b signaling pathway. FKBP12 plays a role in modulation of ryanodine receptor isoform-1 (ryr-1), a component of the calcium release channel of skeletal muscle sarcoplasmic reticulum. FKBP1A increase the folding of proteins and catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.

Product Specifications

Product Name Alternative

FKBP12||PPIase||Peptidyl-prolyl cis-trans isomerase||Rotamase||FKBP-12||FKBP1||PKC12||PKCI2||FKBP12C||FKBP1A||PPIase FKBP1A||FK506-binding protein 1A||12 kDa FKBP||FKBP-1A.

Purification

Greater than 99.0% as determined by SDS-PAGE.

Components

The FKBP1A protein solution contains 50mM Hepes pH-8.0, 150mM NaCl, 0.5mM EDTA & 1mM sodium azide.

Storage Conditions

Store at 4°C if entire vial will be used within 2-4 weeks.Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Avoid multiple freeze-thaw cycles.

Amino Acids

The amino acid sequence of recombinant His-tagged FKBP12 is reported as following:MAHHHHHHVMGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE.
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Testosterone for Lab use
238325-01 1 g

Testosterone for Lab use

Ask
View Details
Testosterone for Lab use
238325-02 5 g

Testosterone for Lab use

Ask
View Details
Testosterone for Lab use
238325-03 25 g

Testosterone for Lab use

Ask
View Details
P4HA3 (prolyl 4-hydroxylase, alpha Polypeptide III) (PE)
249697-PE 100 µL

P4HA3 (prolyl 4-hydroxylase, alpha Polypeptide III) (PE)

Ask
View Details
Recombinant Proteus mirabilis Gamma-glutamyl phosphate reductase (proA)
MBS1220084-01 0.02 mg (E-Coli)

Recombinant Proteus mirabilis Gamma-glutamyl phosphate reductase (proA)

Ask
View Details
Recombinant Proteus mirabilis Gamma-glutamyl phosphate reductase (proA)
MBS1220084-02 0.02 mg (Yeast)

Recombinant Proteus mirabilis Gamma-glutamyl phosphate reductase (proA)

Ask
View Details