Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TARC Recombinant Protein

Source : Escherichia Coli. CCL17 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 71 amino acids and having a molecular mass of 8 kDa. The TARC is purified by proprietary chromatographic techniques. TARC cDNA encodes a 94 amino acid precursor protein with a 23 amino acid residue signal peptide that is cleaved off to generate the 71 amino acid residue mature secreted protein. Along with CC chemokine family members, CCL-17 has approximately 24-29% amino acid sequence identity with RANTES, MIP-1a, MIP-1b, MCP-1, MCP-2, MCP-3 and I-309. TARC is expressed in thymus, and at a lower level in the lung, colon, and small intestine. TARC is in addition transiently expressed in stimulated peripheral blood mononuclear cells. Recombinant TARC has been shown to be chemotactic for T cell lines but not monocytes or neutrophils. CCL-17 was recently identified to be a specific functional ligand for CCR4, a receptor that is selectively expressed on T cells. CCL17 is one of quite a few Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 16. CCL17 shows chemotactic activity for T lymphocytes, but not monocytes or granulocytes. CCL17 binds to chemokine receptors CCR4 and CCR8. This chemokine plays important roles in T cell development in thymus as well as in trafficking and activation of mature T cells.

Product Specifications

Product Name Alternative

C-C motif chemokine 17||Small-inducible cytokine A17||Thymus and activation-regulated chemokine||CC chemokine TARC||ABCD-2||CCL17||CCL-17||SCYA17||TARC||A-152E5.3||MGC138271||MGC138273.

Purification

Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Components

The protein was lyophilized from a concentrated (0.5mg/mL) solution containing 20mM PBS & 150mM NaCl pH-7.4.

Storage Conditions

Lyophilized TARC although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TARC should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles.

Applications Notes

It is recommended to reconstitute the lyophilized CCL17 in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions. Determined by its ability to chemoattract human T-Lymphocytes using a concentration range of 1.0-10.0 ng/ml corresponding to a Specific Activity of 100,000-1,000,000IU/mg.

Amino Acids

ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNK RVKNAVKYLQSLERS.

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CHST4 (Carbohydrate Sulfotransferase 4, Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 3, GST-3, High Endothelial Cells N-acetylglucosamine 6-O-sulfotransferase, HEC-GlcNAc6ST, L-selectin Ligand Sulfotransferase, LSST, N-acetylglucosamine 6-O-sulfotransferase 2, GlcNAc6ST-2, Gn6st-2, Gst3) (MaxLight 550)
124988-ML550 100 µL

CHST4 (Carbohydrate Sulfotransferase 4, Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 3, GST-3, High Endothelial Cells N-acetylglucosamine 6-O-sulfotransferase, HEC-GlcNAc6ST, L-selectin Ligand Sulfotransferase, LSST, N-acetylglucosamine 6-O-sulfotransferase 2, GlcNAc6ST-2, Gn6st-2, Gst3) (MaxLight 550)

Ask
View Details
Vmn2r66 siRNA Oligos set (Mouse)
49810174 3x 5 nmol

Vmn2r66 siRNA Oligos set (Mouse)

Ask
View Details
Human KLB ELISA Kit
ELA-E1003h 96 Tests

Human KLB ELISA Kit

Ask
View Details
Human Homeodomain-only protein, HOPX ELISA KIT
ELI-27101h 96 Tests

Human Homeodomain-only protein, HOPX ELISA KIT

Ask
View Details
Magi3 Rat shRNA Lentiviral Particle (Locus ID 245903)
TL712991V 500 µL Each

Magi3 Rat shRNA Lentiviral Particle (Locus ID 245903)

Ask
View Details
Donkey Jagged 2 Protein (JAG2) ELISA Kit
MBS9905365 Inquire

Donkey Jagged 2 Protein (JAG2) ELISA Kit

Ask
View Details