Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIP 5 Recombinant Protein

Source : Escherichia Coli. Macrophage Inflammatory Protein-5 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 92 amino acids and having a molecular mass of 10.1 kDa. The MIP5 is purified by proprietary chromatographic techniques. CCL15, a new human CC chemokine, was isolated from a human fetal spleen cDNA library. CCL15 cDNA encodes a predicted 113 amino acid (aa) protein containing a putative signal peptide of 21 amino acids that is cleaved to generate a 92 aa residue mature protein. Within the CC family members, human CCL15 shares 45%, 44%, 35%, and 30% aa homology with mouse C10, human MPIF-1, human HCC-1, and mouse MIP-1, respectively. The gene for MIP-5 is found on chromosome 17 where the genes for most of the human CC chemokines are located. Human CCL15 is expressed in T and B lymphocytes, NK cells, monocytes and monocyte-derived dendritic cells. Human MIP-5 is chemotactic for T cells and monocytes and has been shown to induce calcium flux in human CCR-1-transfected cells.

Product Specifications

Product Name Alternative

Small inducible cytokine A15 precursor||CCL15||Macrophage inflammatory protein 5||MIP-5||MIP5||Chemokine CC-2||HCC-2||NCC-3||MIP- 1 delta||Leukotactin-1||LKN-1||Mrp-2b||C-C motif chemokine 15.

Purification

Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Components

MIP5 was lyophilized from a concentrated (1mg/mL) solution containing 20mM PBS pH-7.4 and 100mM NaCl.

Storage Conditions

Lyophilized MIP-5 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CCL15 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles.

Applications Notes

It is recommended to reconstitute the lyophilized MIP5 in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions. Determined by its ability to chemoattract human T-lymphocytes using a concentration range of 1-10 ng/ml corresponding to a Specific Activity of 100,000-1,000,000IU/mg.

Amino Acids

QFINDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKP GVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI.

More Discoveries

Explore Other Products

Browse additional items from our catalog

OASG03777-100UL - IKBKG Antibody - middle region
OASG03777-100UL 100 µL

OASG03777-100UL - IKBKG Antibody - middle region

Sign In for Pricing
View Details
PRAK Polyclonal Antibody
E44H02713 100 µL

PRAK Polyclonal Antibody

Sign In for Pricing
View Details
Elafin (PI3) Antibody (FITC)
abx304823-01 20 µg

Elafin (PI3) Antibody (FITC)

Sign In for Pricing
View Details
Elafin (PI3) Antibody (FITC)
abx304823-02 50 µg

Elafin (PI3) Antibody (FITC)

Sign In for Pricing
View Details
Elafin (PI3) Antibody (FITC)
abx304823-03 100 µg

Elafin (PI3) Antibody (FITC)

Sign In for Pricing
View Details
Elafin (PI3) Antibody (FITC)
abx304823-04 200 µg

Elafin (PI3) Antibody (FITC)

Sign In for Pricing
View Details