Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIP 5 Recombinant Protein

Source : Escherichia Coli. Macrophage Inflammatory Protein-5 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 92 amino acids and having a molecular mass of 10.1 kDa. The MIP5 is purified by proprietary chromatographic techniques. CCL15, a new human CC chemokine, was isolated from a human fetal spleen cDNA library. CCL15 cDNA encodes a predicted 113 amino acid (aa) protein containing a putative signal peptide of 21 amino acids that is cleaved to generate a 92 aa residue mature protein. Within the CC family members, human CCL15 shares 45%, 44%, 35%, and 30% aa homology with mouse C10, human MPIF-1, human HCC-1, and mouse MIP-1, respectively. The gene for MIP-5 is found on chromosome 17 where the genes for most of the human CC chemokines are located. Human CCL15 is expressed in T and B lymphocytes, NK cells, monocytes and monocyte-derived dendritic cells. Human MIP-5 is chemotactic for T cells and monocytes and has been shown to induce calcium flux in human CCR-1-transfected cells.

Product Specifications

Product Name Alternative

Small inducible cytokine A15 precursor||CCL15||Macrophage inflammatory protein 5||MIP-5||MIP5||Chemokine CC-2||HCC-2||NCC-3||MIP- 1 delta||Leukotactin-1||LKN-1||Mrp-2b||C-C motif chemokine 15.

Purification

Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Components

MIP5 was lyophilized from a concentrated (1mg/mL) solution containing 20mM PBS pH-7.4 and 100mM NaCl.

Storage Conditions

Lyophilized MIP-5 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CCL15 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles.

Applications Notes

It is recommended to reconstitute the lyophilized MIP5 in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions. Determined by its ability to chemoattract human T-lymphocytes using a concentration range of 1-10 ng/ml corresponding to a Specific Activity of 100,000-1,000,000IU/mg.

Amino Acids

QFINDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKP GVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI.

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal Twist-1 Antibody
NB120-49254 100 µL

Rabbit Polyclonal Twist-1 Antibody

Ask
View Details
PiggyBac 3 Plasmid
PVTY00351 2 µg

PiggyBac 3 Plasmid

Ask
View Details
Gel Casting System Solution Set
G2180-2L 2 L

Gel Casting System Solution Set

Ask
View Details
Rasa2 Rat shRNA Lentiviral Particle (Locus ID 25597)
TL704322V 500 µL Each

Rasa2 Rat shRNA Lentiviral Particle (Locus ID 25597)

Ask
View Details
TINF2 Blocking Peptide
33R-8348 100 ug

TINF2 Blocking Peptide

Ask
View Details