MIG Recombinant Protein
Source : Escherichia Coli. MIG (monokine induced by gamma-interferon) Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 103 amino acids and having a molecular mass of 11700 Dalton. The MIG is purified by proprietary chromatographic techniques. Chemokine (C-X-C motif) ligand 9 (CXCL9) is a small cytokine belonging to the CXC chemokine family that is also known as Monokine induced by gamma interferon (MIG) . CXCL9 is a T-cell chemoattractant, which is induced by IFN-. It is closely related to two other CXC chemokines called CXCL10 and CXCL11, whose genes are located near the gene for CXCL9 on human chromosome 4. CXCL9, CXCL10 and CXCL11 all elicit their chemotactic functions by interacting with the chemokine receptor CXCR3.
Product Specifications
Product Name Alternative
Purification
Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Components
Lyophilized from a 0.2μm filtered concentrated (1.0mg/mL) solution in 20mM PB, pH 7.4, 50mM NaCl.
Storage Conditions
Applications Notes
Amino Acids
TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT.
Explore Other Products
Browse additional items from our catalog