Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIG Recombinant Protein

Source : Escherichia Coli. MIG (monokine induced by gamma-interferon) Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 103 amino acids and having a molecular mass of 11700 Dalton. The MIG is purified by proprietary chromatographic techniques. Chemokine (C-X-C motif) ligand 9 (CXCL9) is a small cytokine belonging to the CXC chemokine family that is also known as Monokine induced by gamma interferon (MIG) . CXCL9 is a T-cell chemoattractant, which is induced by IFN-. It is closely related to two other CXC chemokines called CXCL10 and CXCL11, whose genes are located near the gene for CXCL9 on human chromosome 4. CXCL9, CXCL10 and CXCL11 all elicit their chemotactic functions by interacting with the chemokine receptor CXCR3.

Product Specifications

Product Name Alternative

Small inducible cytokine B9||CXCL9||Gamma interferon-induced monokine||MIG||chemokine (C-X-C motif) ligand 9||CMK||Humig||SCYB9||crg-10||monokine induced by gamma-interferon.

Purification

Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Components

Lyophilized from a 0.2μm filtered concentrated (1.0mg/mL) solution in 20mM PB, pH 7.4, 50mM NaCl.

Storage Conditions

Lyophilized MIG although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CXCL9 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles.

Applications Notes

It is recommended to reconstitute the lyophilized MIG in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions. Determined by its ability to chemoattract human peripheral blood T-Lymphocytes using a concentration range of 10-100ng/ml corresponding to a Specific Activity of 10,000-100,000IU/mg.

Amino Acids

TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ercalcitriol
M37944-01 1 g

Ercalcitriol

Sign In for Pricing
View Details
Ercalcitriol
M37944-02 500 mg

Ercalcitriol

Sign In for Pricing
View Details
Ercalcitriol
M37944-03 200 mg

Ercalcitriol

Sign In for Pricing
View Details
Ercalcitriol
M37944-04 5 mg

Ercalcitriol

Sign In for Pricing
View Details
Ercalcitriol
M37944-05 10 mg

Ercalcitriol

Sign In for Pricing
View Details
JNK2 Antibody
ABD6382 100 µg

JNK2 Antibody

Sign In for Pricing
View Details