Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIG Recombinant Protein

Source : Escherichia Coli. MIG (monokine induced by gamma-interferon) Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 103 amino acids and having a molecular mass of 11700 Dalton. The MIG is purified by proprietary chromatographic techniques. Chemokine (C-X-C motif) ligand 9 (CXCL9) is a small cytokine belonging to the CXC chemokine family that is also known as Monokine induced by gamma interferon (MIG) . CXCL9 is a T-cell chemoattractant, which is induced by IFN-. It is closely related to two other CXC chemokines called CXCL10 and CXCL11, whose genes are located near the gene for CXCL9 on human chromosome 4. CXCL9, CXCL10 and CXCL11 all elicit their chemotactic functions by interacting with the chemokine receptor CXCR3.

Product Specifications

Product Name Alternative

Small inducible cytokine B9||CXCL9||Gamma interferon-induced monokine||MIG||chemokine (C-X-C motif) ligand 9||CMK||Humig||SCYB9||crg-10||monokine induced by gamma-interferon.

Purification

Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Components

Lyophilized from a 0.2μm filtered concentrated (1.0mg/mL) solution in 20mM PB, pH 7.4, 50mM NaCl.

Storage Conditions

Lyophilized MIG although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CXCL9 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles.

Applications Notes

It is recommended to reconstitute the lyophilized MIG in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions. Determined by its ability to chemoattract human peripheral blood T-Lymphocytes using a concentration range of 10-100ng/ml corresponding to a Specific Activity of 10,000-100,000IU/mg.

Amino Acids

TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT.

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

APC/Fire™ 750 anti-mouse H-2Db
GT02030 100 µg

APC/Fire™ 750 anti-mouse H-2Db

Ask
View Details
Anti-TLR1 Antibody
STJ503276 100 µg

Anti-TLR1 Antibody

Ask
View Details
FOXB2, NT (FOXB2, Forkhead box protein B2) (MaxLight 650) discontinued
035723-ML650 100 µL

FOXB2, NT (FOXB2, Forkhead box protein B2) (MaxLight 650) discontinued

Ask
View Details
Anti-WIPI1  (3C1)
YF-MA18725 100 ug

Anti-WIPI1 (3C1)

Ask
View Details
Serine Palmitoyltransferase, Long Chain Base Subunit 3 (SPTLC3) Antibody
abx178364-01 100 µL

Serine Palmitoyltransferase, Long Chain Base Subunit 3 (SPTLC3) Antibody

Ask
View Details
Serine Palmitoyltransferase, Long Chain Base Subunit 3 (SPTLC3) Antibody
abx178364-02 200 µL

Serine Palmitoyltransferase, Long Chain Base Subunit 3 (SPTLC3) Antibody

Ask
View Details