Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCP 4 Recombinant Protein

Source : Escherichia Coli. Monocyte Chemotactic Protein-4 Human Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 75 amino acids and having a molecular mass of 8.6 kDa. The MCP-4 is purified by proprietary chromatographic techniques. Chemokine (C-C motif) ligand 13 (CCL13 / MCP-4) is a small cytokine belonging to the CC chemokine family. The MCP-4 gene is located on human chromosome 17 within a large cluster of other CC chemokines. MCP-4 induces chemotaxis in monocytes, eosinophils, T lymphocytes, and basophils by binding cell surface G-protein linked chemokine receptors such as CCR2, CCR3 and CCR5. Activity of the MCP-4 chemokine has been implicated in allergic reactions such as asthma. MCP-4 can be induced by the inflammatory cytokines interleukin-1 and TNF-a.

Product Specifications

Product Name Alternative

Small inducible cytokine A13||CCL13||Monocyte chemotactic protein 4||MCP-4||Monocyte chemoattractant protein 4||CK-beta-10||NCC-1||chemokine (C-C motif) ligand 13||NCC1||CKb10||SCYL1||SCYA13||MGC17134.

Purification

Greater than 96.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Components

The protein was lyophilized from a concentrated (1mg/mL) sterile solution in 20mM PB, pH 7.4, 130mM NaCl.

Storage Conditions

Lyophilized MCP-4 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MCP-4 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles.

Applications Notes

It is recommended to reconstitute the lyophilized MCP-4 in sterile 18M-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions. The specific activity as determined by the ability of MCP-4 to chemoattaract human monocytes at 10-100ng/ml, corresponding to a Specific Activity of 10,000-100,000 units/mg.

Amino Acids

QPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT.

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Metalloproteinase Inhibitor 4 (TIMP4) Antibody
abx109995-01 20 µg

Metalloproteinase Inhibitor 4 (TIMP4) Antibody

Ask
View Details
Metalloproteinase Inhibitor 4 (TIMP4) Antibody
abx109995-02 50 µg

Metalloproteinase Inhibitor 4 (TIMP4) Antibody

Ask
View Details
Metalloproteinase Inhibitor 4 (TIMP4) Antibody
abx109995-03 100 µg

Metalloproteinase Inhibitor 4 (TIMP4) Antibody

Ask
View Details
Metalloproteinase Inhibitor 4 (TIMP4) Antibody
abx109995-04 200 µg

Metalloproteinase Inhibitor 4 (TIMP4) Antibody

Ask
View Details
Metalloproteinase Inhibitor 4 (TIMP4) Antibody
abx109995-05 1 mg

Metalloproteinase Inhibitor 4 (TIMP4) Antibody

Ask
View Details
AdmiRa-mmu-miR-7227-5p Virus
mm1971 250 µL

AdmiRa-mmu-miR-7227-5p Virus

Ask
View Details