Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IP 10 Recombinant Protein

Source : Escherichia Coli. IP-10 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 77 amino acids and having a molecular mass of 8.5kDa. The IP-10 is purified by proprietary chromatographic techniques. Chemokine (C-X-C motif) ligand 10 (CXCL10) is a small cytokine belonging to the CXC chemokine family that is also known as 10 kDa interferon-gamma-induced protein (-IP10 or IP-10) . CXCL10 is secreted by several cell types in response to IFN-. These cell types include monocytes, endothelial cells and fibroblasts. CXCL10 has been attributed to several roles, such as chemoattraction for monocytes and T cells, promotion of T cell adhesion to endothelial cells, antitumor activity, and inhibition of bone marrow colony formation and angiogenesis. The gene for CXCL10 is located on human chromosome 4 in a cluster among several other CXC chemokines. This chemokine elicits its effects by binding to the cell surface chemokine receptor CXCR3. The three-dimensional crystal structure of this chemokine has been determined under 3 different conditions to a resolution of up to 1.92A.

Product Specifications

Product Name Alternative

Small inducible cytokine B10||CXCL10||10 kDa interferon-gamma-induced protein||Gamma-IP10||IP-10||chemokine (C-X-C motif) ligand 10||C7||IFI10||INP10||crg-2||mob-1||SCYB10||gIP-10.

Purification

Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Components

Lyophilized from a 0.2μm filtered concentrated (0.5mg/mL) solution in 20mM PB, pH 7.4 and 150mM NaCl.

Storage Conditions

Lyophilized IP-10 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CXCL10 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles.

Applications Notes

It is recommended to reconstitute the lyophilized IP-10 in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions. Determined by its ability to chemoattract human T-Lymphocytes using a concentration range of 10-100ng/ml corresponding to a Specific Activity of 10,000-100,000IU/mg.

Amino Acids

VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKA IKNLLKAVSKEMSKRSP.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp207 (NM_001130171) Mouse Tagged ORF Clone
MR207419 10 µg

Zfp207 (NM_001130171) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
BMAL1 Rabbit pAb
E47R3750 100 µL

BMAL1 Rabbit pAb

Sign In for Pricing
View Details
Frozen Tissue Sections, Liver
CS602454 5x 5 µm

Frozen Tissue Sections, Liver

Sign In for Pricing
View Details
Pla2g3 (NM_172791) Mouse Tagged Lenti ORF Clone
MR208107L3 10 µg

Pla2g3 (NM_172791) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Synaptojanin 1 Antibody
bsm-70272M 100 µL

Synaptojanin 1 Antibody

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli kpsS Polyclonal Antibody
MBS7157671 Inquire

Rabbit anti-Escherichia coli kpsS Polyclonal Antibody

Sign In for Pricing
View Details