Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HCC 1 Recombinant Protein

Source : Escherichia Coli. HCC-1 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 72 amino acids and having a molecular mass of 8411 Dalton. The HCC-1 is purified by proprietary chromatographic techniques. Chemokine (C-C motif) ligand 14 (CCL14) is a small cytokine belonging to the CC chemokine family. It is also commonly known as HCC-1. It is produced as a protein precursor that is procesed to generate a mature active protein containing 74 amino acids that and is 46% identical in amino acid composition to CCL3 and CCL4. This chemokine is expressed in various tissues including spleen, bone marrow, liver, muscle, and gut. CCL13 activates monocytes, but does not induce their chemotaxis. Human CCL13 is located on chromosome 17 within a cluster of other chemokines belonging to the CC family.

Product Specifications

Product Name Alternative

Small inducible cytokine A14||CCL14||Chemokine CC-1/CC-3||HCC-1/HCC-3||HCC-1 (1-74) ||NCC-2||chemokine (C-C motif) ligand 14||CC-1||CC-3||CKb1||MCIF||SY14||HCC-1||HCC-3||SCYL2||SCYA14.

Purification

Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Components

The CCL14 protein was lyophilized with 20mM PBS pH-7.4 and 150mM NaCl.

Storage Conditions

Lyophilized HCC1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CCL14 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles.

Applications Notes

It is recommended to reconstitute the lyophilized HCC-1 in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions. The Biological activity is calculated by its ability to chemoattract Human monocytes at 5-20ng/ml corresponding to a Specific Activity of 50,000-200,000IU/mg.

Amino Acids

TESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN.

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human RPH3A qPCR Primer Pair
QH34233S 200 Tests

Human RPH3A qPCR Primer Pair

Ask
View Details
Pentanoic-5,5,5-d3 Acid
TRC-P274360-100MG 100 mg

Pentanoic-5,5,5-d3 Acid

Ask
View Details
Olfr857 (NM_001012265) Mouse Tagged Lenti ORF Clone
MR225656L4 10 µg

Olfr857 (NM_001012265) Mouse Tagged Lenti ORF Clone

Ask
View Details
Chicken Frizzled-3, FZD3 ELISA Kit
MBS9335312 Inquire

Chicken Frizzled-3, FZD3 ELISA Kit

Ask
View Details
PSMA1 Antibody-middle region
MBS3249867-01 0.1 mL

PSMA1 Antibody-middle region

Ask
View Details
PSMA1 Antibody-middle region
MBS3249867-02 5x 0.1 mL

PSMA1 Antibody-middle region

Ask
View Details