Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fractalkine Recombinant Protein

Source : Escherichia Coli. Fractalkine Human Recombinant- produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 76 amino acids and having a molecular mass of 8638 Dalton. The Fractalkine is purified by proprietary chromatographic techniques. Fractalkine soluble form is chemotactic for t-cells and monocytes, but not for neutrophils. Fractalkine membrane-bound form promotes adhesion of those leukocytes to endothelial cells. Fractalkine regulates leukocyte adhesion and migration processes at the endothelium and binds to CX3CR1. Natural Human Fractalkine is produced as a long protein (373-amino acid) with an extended mucin-like stalk and a chemokine domain on top. The mucin-like stalk permits it to bind to the cell surface. Fractalkine gene is located on human chromosome 16 along with some CC chemokines known as CCL17 and CCL22.

Product Specifications

Product Name Alternative

Fractalkine||CX3CL1||Neurotactin||CX3C membrane-anchored chemokine||Small inducible cytokine D1||NTN||NTT||CXC3||CXC3C||SCYD1||ABCD-3||C3Xkine.

Purification

Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Components

The CX3CL1 was lyophilized from a 0.2μm filtered concentrated (1.0 mg/mL) solution in 20mM Phosphate buffer, pH 7.4, 50mM NaCl.

Storage Conditions

Lyophilized CX3CL1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CX3CL1 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles.

Applications Notes

It is recommended to reconstitute the lyophilized CX3CL1 in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions. The Biological activity is calculated by its ability to chemoattract human T-Lymphocytes using a concentration range of 5.0-10.0 ng/ml corresponding to a Specific Activity of 100,000-200,000IU/mg.

Amino Acids

QHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQW VKDAMQHLDRQAAALTRNG.

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

5-fluoro-2-methoxyphenol
436487-01 100 mg

5-fluoro-2-methoxyphenol

Ask
View Details
5-fluoro-2-methoxyphenol
436487-02 250 mg

5-fluoro-2-methoxyphenol

Ask
View Details
SGOL1 (Shugoshin-like 1 (S. pombe), NY-BR-85, SGO, Sgo1) (FITC)
MBS6175255-01 0.1 mL

SGOL1 (Shugoshin-like 1 (S. pombe), NY-BR-85, SGO, Sgo1) (FITC)

Ask
View Details
SGOL1 (Shugoshin-like 1 (S. pombe), NY-BR-85, SGO, Sgo1) (FITC)
MBS6175255-02 5x 0.1 mL

SGOL1 (Shugoshin-like 1 (S. pombe), NY-BR-85, SGO, Sgo1) (FITC)

Ask
View Details
Drebrin (DBN1) Antibody
abx456214-01 50 µg

Drebrin (DBN1) Antibody

Ask
View Details
Drebrin (DBN1) Antibody
abx456214-02 100 µg

Drebrin (DBN1) Antibody

Ask
View Details