Fractalkine Recombinant Protein
Source : Escherichia Coli. Fractalkine Human Recombinant- produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 76 amino acids and having a molecular mass of 8638 Dalton. The Fractalkine is purified by proprietary chromatographic techniques. Fractalkine soluble form is chemotactic for t-cells and monocytes, but not for neutrophils. Fractalkine membrane-bound form promotes adhesion of those leukocytes to endothelial cells. Fractalkine regulates leukocyte adhesion and migration processes at the endothelium and binds to CX3CR1. Natural Human Fractalkine is produced as a long protein (373-amino acid) with an extended mucin-like stalk and a chemokine domain on top. The mucin-like stalk permits it to bind to the cell surface. Fractalkine gene is located on human chromosome 16 along with some CC chemokines known as CCL17 and CCL22.
Product Specifications
Product Name Alternative
Fractalkine||CX3CL1||Neurotactin||CX3C membrane-anchored chemokine||Small inducible cytokine D1||NTN||NTT||CXC3||CXC3C||SCYD1||ABCD-3||C3Xkine.
Purification
Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Components
The CX3CL1 was lyophilized from a 0.2μm filtered concentrated (1.0 mg/mL) solution in 20mM Phosphate buffer, pH 7.4, 50mM NaCl.
Storage Conditions
Applications Notes
Amino Acids
QHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQW VKDAMQHLDRQAAALTRNG.
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items