Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eotaxin 2 Recombinant Protein

Source : Escherichia Coli. CCL24 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 78 amino acids and having a molecular mass of 8.8 kDa. The CCL24 is purified by proprietary chromatographic techniques. Eotaxin-2, also called MPIF2 & Ckb6, is a novel CC chemokine produced by activated monocytes and T lymphocytes. Eotaxin-2 selectively chemoattracts cells expressing CCR3 including eosinophils, basophils, Th2 T cells, mast cells, and certain subsets of dendritic cells. Furthermore, Eotaxin-2 inhibits the proliferation of multipotential hematopoietic progenitor cells. The mature protein, which includes C-terminal truncation, contains 78 amino acids (92 amino acids for the mouse homolog, without C-terminal truncation) .CCL24 functions as a chemotactic chemokine for resting t-lymphocytes, and eosinophils. CCL24 has lower chemotactic activity for neutrophils but none for monocytes and activated lymphocytes. CCL24 is a strong suppressor of colony formation by a multipotential hematopoietic progenitor cell line and binds to CCR3.

Product Specifications

Product Name Alternative

C-C motif chemokine 24||Small-inducible cytokine A24||Myeloid progenitor inhibitory factor 2||CK-beta-6||Eosinophil chemotactic protein 2||Eotaxin-2||CCL24||Ckb-6||MPIF2||MPIF-2||SCYA24||Eotaxin2||CCL-24.

Purification

Greater than 97.0% as determined by (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Components

The CCL24 protein was lyophilized from a concentrated (1mg/mL) sterile solution containing 20mM PBS pH-7.4 and 0.15M sodium chloride.

Storage Conditions

Lyophilized Eotaxin-2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CCL24 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles.

Applications Notes

It is recommended to reconstitute the lyophilized CCL24 Human Recombinant in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions. The activity is determined by the chemoattract of human PBE (peripheral blood eosinophils) at a concentration between 50-100 ng/ml corresponding to a Specific Activity of 10,000-20,000IU/mg.

Amino Acids

VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKGGVIFTTKKGQQFCGDPKQEWV QRYMKNLDAKQKKASPRARAVA.

More Discoveries

Explore Other Products

Browse additional items from our catalog

HiShield HC
CO192-1X6NO 1 unit

HiShield HC

Sign In for Pricing
View Details
PYST2 Lentiviral Activation Particles (h)
sc-404642-LAC 200 µL

PYST2 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Tppp2 3'UTR GFP Stable Cell Line
TU170997 1.0 mL

Tppp2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
ACP1 Protein Vector (Human) (pPB-N-His)
PV000378 500 ng

ACP1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
LOC283129 siRNA (h)
sc-96911 10 µM

LOC283129 siRNA (h)

Sign In for Pricing
View Details
Quick Step Human prothrombin factor 1 ELISA Kit
QSD4208Hu-01 48 Tests

Quick Step Human prothrombin factor 1 ELISA Kit

Sign In for Pricing
View Details