Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eotaxin 2 Recombinant Protein

Source : Escherichia Coli. CCL24 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 78 amino acids and having a molecular mass of 8.8 kDa. The CCL24 is purified by proprietary chromatographic techniques. Eotaxin-2, also called MPIF2 & Ckb6, is a novel CC chemokine produced by activated monocytes and T lymphocytes. Eotaxin-2 selectively chemoattracts cells expressing CCR3 including eosinophils, basophils, Th2 T cells, mast cells, and certain subsets of dendritic cells. Furthermore, Eotaxin-2 inhibits the proliferation of multipotential hematopoietic progenitor cells. The mature protein, which includes C-terminal truncation, contains 78 amino acids (92 amino acids for the mouse homolog, without C-terminal truncation) .CCL24 functions as a chemotactic chemokine for resting t-lymphocytes, and eosinophils. CCL24 has lower chemotactic activity for neutrophils but none for monocytes and activated lymphocytes. CCL24 is a strong suppressor of colony formation by a multipotential hematopoietic progenitor cell line and binds to CCR3.

Product Specifications

Product Name Alternative

C-C motif chemokine 24||Small-inducible cytokine A24||Myeloid progenitor inhibitory factor 2||CK-beta-6||Eosinophil chemotactic protein 2||Eotaxin-2||CCL24||Ckb-6||MPIF2||MPIF-2||SCYA24||Eotaxin2||CCL-24.

Purification

Greater than 97.0% as determined by (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Components

The CCL24 protein was lyophilized from a concentrated (1mg/mL) sterile solution containing 20mM PBS pH-7.4 and 0.15M sodium chloride.

Storage Conditions

Lyophilized Eotaxin-2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CCL24 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles.

Applications Notes

It is recommended to reconstitute the lyophilized CCL24 Human Recombinant in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions. The activity is determined by the chemoattract of human PBE (peripheral blood eosinophils) at a concentration between 50-100 ng/ml corresponding to a Specific Activity of 10,000-20,000IU/mg.

Amino Acids

VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKGGVIFTTKKGQQFCGDPKQEWV QRYMKNLDAKQKKASPRARAVA.

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Tempasure low temperature indicator, +10°C
1211109 10 PCKS

Tempasure low temperature indicator, +10°C

Ask
View Details
Recombinant Streptomyces coelicolor Ornithine carbamoyltransferase (argF)
MBS1417366-01 0.02 mg (E-Coli)

Recombinant Streptomyces coelicolor Ornithine carbamoyltransferase (argF)

Ask
View Details
Recombinant Streptomyces coelicolor Ornithine carbamoyltransferase (argF)
MBS1417366-02 0.02 mg (Yeast)

Recombinant Streptomyces coelicolor Ornithine carbamoyltransferase (argF)

Ask
View Details
Recombinant Streptomyces coelicolor Ornithine carbamoyltransferase (argF)
MBS1417366-03 0.1 mg (E-Coli)

Recombinant Streptomyces coelicolor Ornithine carbamoyltransferase (argF)

Ask
View Details
Recombinant Streptomyces coelicolor Ornithine carbamoyltransferase (argF)
MBS1417366-04 0.1 mg (Yeast)

Recombinant Streptomyces coelicolor Ornithine carbamoyltransferase (argF)

Ask
View Details
Recombinant Streptomyces coelicolor Ornithine carbamoyltransferase (argF)
MBS1417366-05 0.02 mg (Baculovirus)

Recombinant Streptomyces coelicolor Ornithine carbamoyltransferase (argF)

Ask
View Details