Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCL16 Recombinant Protein

Source : Escherichia Coli. CCL16 Human Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 97 amino acids and having a molecular mass of 11.2 kDa. The CCL16 is purified by proprietary chromatographic techniques. Human CCL16, also called HCC-4, liver-expressed chemokine (LEC), and lymphocyte and monocyte chemoattractant (LMC), is a novel CC chemokine recognized by bioinformatics. NCC-4 cDNA encodes a 120 amino acids along with a 23 amino acids signal peptide that is cleaved to generate 97 amino acid protein. HCC4 is vaguely related to other CC chemokines, showing less than 30% sequence identity. Among CC chemokines, CCL-16 has the largest similarity to HCC-1. 2 potential polyadenylation signals are present on the human HCC-4 gene, and as a result, 2 transcripts containing roughly 1,500 base pairs and 500 base pairs have been detected. HCC-4 is expressed weakly by some lymphocytes, including NK cells, T cells, and some T cell clones. The expression of HCC-4 in monocytes is greatly upregulated in the presence of IL-10. CCL16 shows chemotactic activity for lymphocytes and monocytes rather than to neutrophils. NCC-4 has potent myelosuppressive activity, suppresses proliferation of myeloid progenitor cells. CCL16 demonstrates chemotactic activity for monocytes and thp-1 monocytes, rather than for resting lymphocytes and neutrophils. HCC-4 induces a calcium flux in thp-1 cells that desensitized prior to the expression of rantes.

Product Specifications

Product Name Alternative

C-C motif chemokine 16||Small-inducible cytokine A16||IL-10-inducible chemokine||Chemokine LEC||Monotactin-1||Chemokine CC-4||Lymphocyte and monocyte chemoattractant||CCL-16||HCC-4||HCC4||NCC4||NCC-4||Liver Expressed Chemokine||LMC||LCC-1||LCC1||MTN-

Purification

Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Components

The CCL16 protein was lyophilized from a concentrated (1mg/mL) sterile solution containing 20mM PBS pH-7.4 and 0.15M sodium chloride.

Storage Conditions

Lyophilized CCL16 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CCL16 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles.

Applications Notes

It is recommended to reconstitute the lyophilized CCL16in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions. Determined by its ability to chemoattract total human monocytes using a concentration range of 10-100 ng/ml corresponding to a Specific Activity of 10,000-100,000IU/mg.

Amino Acids

QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNP NDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hormad1 3'UTR Luciferase Stable Cell Line
TU109669 1.0 mL

Hormad1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
GRK1 Rabbit Polyclonal Antibody (Carrier-free)
orb3106759 100 µg

GRK1 Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
Sheep YM1/Chitinase 3-like 3 ELISA
GTR10447173 96 Well

Sheep YM1/Chitinase 3-like 3 ELISA

Sign In for Pricing
View Details
Anti-GSTK1 Antibody, Rabbit Polyclonal
MBS8107301-01 0.1 mL

Anti-GSTK1 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-GSTK1 Antibody, Rabbit Polyclonal
MBS8107301-02 5x 0.1 mL

Anti-GSTK1 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
EF-CBP2 Polyclonal Antibody, Cy7 Conjugated
bs-9016R-Cy7 100 µL

EF-CBP2 Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details