Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCA 1 Recombinant Protein

Source : Escherichia Coli. CXCL13 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 87 amino acids and having a molecular mass of 10.3 kDa. The BCA-1 is purified by proprietary chromatographic techniques. BCA-1 is a CXC chemokine that is highly expressed in thesecondary lymphoid organs, such as follicles of the spleen, lymph nodes, and Peyer's patches. CXCL13 promotes the migration of B lymphocytes (compared to T cells and macrophages), by stimulating calcium influx into, and chemotaxis of, cells expressing Burkitt's lymphoma receptor 1 (BLR1) . BCA1 therefore function in the homing of B lymphocytes to follicles. Human BCA-1 shares a 64% amino acid sequence similarity with the mouse protein and 23 - 34% amino acid sequence identity with other known CXC chemokines. Recombinant or chemically synthesized BCA1 is a potent chemoattractant for B lymphocytes but not T lymphocytes, monocytes or neutrophils. BLR1, a G protein-coupled receptor originally isolated from Burkitt's lymphoma cells, has now been shown to be the specific receptor for BCA1. Among cells of the hematopoietic lineages, the expression of BLR-1, now designated CXCR-5, is restricted to B lymphocytes and a subpopulation of T helper memory cells.

Product Specifications

Product Name Alternative

C-X-C motif chemokine 13||Small-inducible cytokine B13||B lymphocyte chemoattractant||CXC chemokine BLC||CXCL13||BCA1||BCA-1||CXCL-13||B cell Attracting Chemokine-1||BLC||ANGIE||BLR1L||SCYB13||ANGIE2.

Purification

Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Components

The BCA-1 protein was lyophilized from a concentrated (0.5mg/mL) solution containing 20mM PBS & 150mM NaCl pH-7.4.

Storage Conditions

Lyophilized BCA1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution BCA1 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles.

Applications Notes

It is recommended to reconstitute the lyophilized CXCL13 in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions. Determined by its ability to chemoattract human B cells using a concentration range of 1-10ng/ml corresponding to a Specific Activity of 100,000-1,000,000IU/mg.

Amino Acids

VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNG CPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKR SSSTLPVPVFKRKIP.

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

MIWI Antibody
MBS856783-01 0.1 mg

MIWI Antibody

Ask
View Details
MIWI Antibody
MBS856783-02 0.1 mL (AF405L)

MIWI Antibody

Ask
View Details
MIWI Antibody
MBS856783-03 0.1 mL (AF405S)

MIWI Antibody

Ask
View Details
MIWI Antibody
MBS856783-04 0.1 mL (AF610)

MIWI Antibody

Ask
View Details
MIWI Antibody
MBS856783-05 0.1 mL (AF635)

MIWI Antibody

Ask
View Details
MIWI Antibody
MBS856783-06 0.1 mL (APC)

MIWI Antibody

Ask
View Details