Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCA 1 Recombinant Protein

Source : Escherichia Coli. CXCL13 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 87 amino acids and having a molecular mass of 10.3 kDa. The BCA-1 is purified by proprietary chromatographic techniques. BCA-1 is a CXC chemokine that is highly expressed in thesecondary lymphoid organs, such as follicles of the spleen, lymph nodes, and Peyer's patches. CXCL13 promotes the migration of B lymphocytes (compared to T cells and macrophages), by stimulating calcium influx into, and chemotaxis of, cells expressing Burkitt's lymphoma receptor 1 (BLR1) . BCA1 therefore function in the homing of B lymphocytes to follicles. Human BCA-1 shares a 64% amino acid sequence similarity with the mouse protein and 23 - 34% amino acid sequence identity with other known CXC chemokines. Recombinant or chemically synthesized BCA1 is a potent chemoattractant for B lymphocytes but not T lymphocytes, monocytes or neutrophils. BLR1, a G protein-coupled receptor originally isolated from Burkitt's lymphoma cells, has now been shown to be the specific receptor for BCA1. Among cells of the hematopoietic lineages, the expression of BLR-1, now designated CXCR-5, is restricted to B lymphocytes and a subpopulation of T helper memory cells.

Product Specifications

Product Name Alternative

C-X-C motif chemokine 13||Small-inducible cytokine B13||B lymphocyte chemoattractant||CXC chemokine BLC||CXCL13||BCA1||BCA-1||CXCL-13||B cell Attracting Chemokine-1||BLC||ANGIE||BLR1L||SCYB13||ANGIE2.

Purification

Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Components

The BCA-1 protein was lyophilized from a concentrated (0.5mg/mL) solution containing 20mM PBS & 150mM NaCl pH-7.4.

Storage Conditions

Lyophilized BCA1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution BCA1 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles.

Applications Notes

It is recommended to reconstitute the lyophilized CXCL13 in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions. Determined by its ability to chemoattract human B cells using a concentration range of 1-10ng/ml corresponding to a Specific Activity of 100,000-1,000,000IU/mg.

Amino Acids

VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNG CPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKR SSSTLPVPVFKRKIP.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Duck Placental Protein ELISA Kit
MBS079128 Inquire

Duck Placental Protein ELISA Kit

Sign In for Pricing
View Details
2- (4-Fluorophenoxy) nicotinic acid
sc-273877 1 g

2- (4-Fluorophenoxy) nicotinic acid

Sign In for Pricing
View Details
NTSR2 Protein Vector (Human) (pPM-C-HA)
32258021 500 ng

NTSR2 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
UDP Glucuronosyltransferase 1 Family, Polypeptide A1 (UGT1A1) Antibody (FITC)
abx338240-01 20 µg

UDP Glucuronosyltransferase 1 Family, Polypeptide A1 (UGT1A1) Antibody (FITC)

Sign In for Pricing
View Details
UDP Glucuronosyltransferase 1 Family, Polypeptide A1 (UGT1A1) Antibody (FITC)
abx338240-02 50 µg

UDP Glucuronosyltransferase 1 Family, Polypeptide A1 (UGT1A1) Antibody (FITC)

Sign In for Pricing
View Details
UDP Glucuronosyltransferase 1 Family, Polypeptide A1 (UGT1A1) Antibody (FITC)
abx338240-03 100 µg

UDP Glucuronosyltransferase 1 Family, Polypeptide A1 (UGT1A1) Antibody (FITC)

Sign In for Pricing
View Details