Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RVEGFC Recombinant Protein

Source : Sf9, Insect Cells. Vascular Endothelial Growth Factor C Rat Recombinant contains 129 amino acids residues and was fused to a His- tag (6x His) at the C-terminal end. As a result of glycosylation VEGF-C migrates as an 18-24 kDa protein in SDS-PAGE under reducing conditions. VEGF-C, also known as Vascular Endothelial Growth Factor Related Protein (VRP), is a recently discovered VEGF growth factor family member that is most closely related to VEGF-D. The rat VEGFC cDNA encodes a pre-pro-protein of 416 amino acids residues. It is almost identical to the mouse VEGF-C protein. Similar to VEGF-D, VEGF-C has a VEGF homology domain spanning the middle third of the precursor molecule and long N- and C-terminal extensions. In adults, VEGF-C is highly expressed in heart, placenta, ovary and small intestine. Recombinant rat VEGF-C, lacking the N- and C-terminal extensions and containing only the middle VEGF homology domain, forms primarily non-covalently linked dimers. This protein is a ligand for both VEGFR-2/KDR and VEGFR-3/FLT -4. Since VEGFR-3 is strongly expressed in lymphatic endothelial cells, it has been postulated that VEGF-C is involved in the regulation of the growth and/or differentiation of lymphatic endothelium. Although recombinant rat VEGF-C is also a mitogen for vascular endothelial cells, it is much less potent than VEGF-A.

Product Specifications

Product Name Alternative

VEGF-C||Vascular endothelial growth factor C||VRP||Flt4 ligand||Flt4-L.

Purification

Greater than 90.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Components

Each mg of VEGF-C Rat contains 50mg BSA and PBS as buffer.

Storage Conditions

Lyophilized Vascular Endothelial Growth Factor-C although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution VEGF-C should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles.

Applications Notes

It is recommended to reconstitute the lyophilized Vascular Endothelial Growth Factor C in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions. Measured by its ability to stimulate phosphorylation of the VEGFR-3/FLT-4 receptor in porcine aortic endothelial cells. The ED50 for this effect is typically 200-300ng/ml corresponding to a Specific Activity of 3,334-5,000IU/mg.

Amino Acids

DTVKLAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKP PCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFA NHTSCRCMSKLDVYRQVHSIIHHHHHH.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Cxcr3 shRNA (UAS) - Lentiviral mouse Cxcr3 shRNA (UAS) (25)
GTR15175397 1 Vial

Lentiviral mouse Cxcr3 shRNA (UAS) - Lentiviral mouse Cxcr3 shRNA (UAS) (25)

Sign In for Pricing
View Details
Neuronatin Polyclonal Antibody
MBS9234104-01 0.1 mL

Neuronatin Polyclonal Antibody

Sign In for Pricing
View Details
Neuronatin Polyclonal Antibody
MBS9234104-02 5x 0.1 mL

Neuronatin Polyclonal Antibody

Sign In for Pricing
View Details
Rat Klhl23 Pre-designed siRNA Set A
SI207314A 1 Each

Rat Klhl23 Pre-designed siRNA Set A

Sign In for Pricing
View Details
NECAB1 Recombinant Protein Antigen
NBP2-52944PEP 0.1 mL

NECAB1 Recombinant Protein Antigen

Sign In for Pricing
View Details
Human PTP4A3 qPCR Primer Pair
QH33437S 200 Tests

Human PTP4A3 qPCR Primer Pair

Sign In for Pricing
View Details