Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGFC HEK Recombinant Protein

Source : HEK293 cells. VEGFC Human Recombinant produced by transfected human cells is a single polypeptide chain containing 204 amino acids (32-227) . VEGFC is fused to an 8 amino acid His-tag at C-terminus & purified by proprietary chromatographic techniques. VEGF-C, also known as Vascular Endothelial Growth Factor Related Protein (VRP), is a recently discovered VEGF growth factor family member that is most closely related to VEGF-D. Human VEGF-C cDNA encodes a pre-pro-protein of 416 amino acids residues. It is almost identical to the mouse VEGF-C protein. Similar to VEGF-D, VEGF-C has a VEGF homology domain spanning the middle third of the precursor molecule and long N- and C-terminal extensions. In adults, VEGF-C is highly expressed in heart, placenta, ovary and small intestine. Recombinant human VEGF-C, lacking the N- and C-terminal extensions and containing only the middle VEGF homology domain, forms primarily non-covalently linked dimers. This protein is a ligand for both VEGFR-2/KDR and VEGFR-3/FLT-4. Since VEGFR-3 is strongly expressed in lymphatic endothelial cells, it has been postulated that VEGF-C is involved in the regulation of the growth and/or differentiation of lymphatic endothelium. Although recombinant human VEGF-C is also a mitogen for vascular endothelial cells, it is much less potent than VEGF-A.

Product Specifications

Product Name Alternative

VEGF-C||Vascular endothelial growth factor C||VRP||Flt4 ligand||Flt4-L||Vascular endothelial growth factor-related protein||VEGFC.

Purification

Greater than 95% as determined by SDS-PAGE.

Components

VEGFC was lyophilized from a 0.2 mM filtered solution of 20mM Tris-HCl and 150mM NaCl, pH 7.2.

Storage Conditions

Lyophilized VEGFC although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution VEGFC should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.

Applications Notes

It is recommended to reconstitute the lyophilized VEGFC in 1xPBS to a concentration no less than 100 μg/ml, which can then be further diluted to other aqueous solutions.

Amino Acids

FESGLDLSDAEPDAGEATAYASKDLEEQLRSVSSVDELMTVLYPEYWKMYKCQLRKGGWQHNREQANLNSRTEETIKFAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRRVDHHHHHH.
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

VPS37D (NM_001077621) Human Tagged ORF Clone
RC211427 10 µg

VPS37D (NM_001077621) Human Tagged ORF Clone

Ask
View Details
FEM 1C (FEM1C) Human qPCR Primer Pair (NM_020177)
HP213533 200 Reactions

FEM 1C (FEM1C) Human qPCR Primer Pair (NM_020177)

Ask
View Details
US12 (NC_001798) Virus Tagged ORF Clone
VC100938 10 µg

US12 (NC_001798) Virus Tagged ORF Clone

Ask
View Details
RFPL4A Antibody
A44619-100UL 100 µL

RFPL4A Antibody

Ask
View Details
PCDHGA3, ID (PCDHGA3, Protocadherin gamma-A3) (FITC) discontinued
039752-FITC 200 µL

PCDHGA3, ID (PCDHGA3, Protocadherin gamma-A3) (FITC) discontinued

Ask
View Details