Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TGF beta 2 Recombinant Protein

Source : Nicotiana benthamiana. TGFB2 Human Recombinant produced in plants is a homodimeric polypeptide chain containing 2 x 118 amino acids and having a total molecular mass of 27.08kDa. The TGFB2 is fused to 6xHis Tag at N-terminus and purified by proprietary chromatographic techniques. TGFB2 is a 27.08 kDa protein having two identical 118 amino acid peptide chains linked by a single disulfide bond. TGFB2 is part of a family of five related cytokines that have an extensive variation of normal and neoplastic cells, indicating the importance of these homo-dimmer proteins as multi-functional regulators of cellular activity. The three mammalian isoforms of TGF- Beta (TGFb1, TGFb2 and TGFb3) signal through the same receptor and stimulate similar biological responses. They are involved in physiological processes as embryogenesis, tissue remodelling and wound healing.

Product Specifications

Product Name Alternative

Transforming growth factor||beta 2||cetermin||Glioblastoma-derived T-cell suppressor factor||polyergin||G-TSF||TGF-beta2||TGF-beta-2||transforming growth factor beta-2||BSC-1 cell growth inhibitor||TGFB-2.

Purification

Greater than 97.0% as determined by SDS-PAGE.

Components

Lyophilized from a concentrated (1mg/mL) solution containing 50mM Tris-HCl pH-7.4.

Storage Conditions

Lyophilized TGFB2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TGFB2 Human should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) . Please prevent freeze-thaw cycles.

Applications Notes

It is recommended to reconstitute the lyophilized TGFB2 in sterile 18M-cm H2O not less than 1μg/40μl, which can then be further diluted to other aqueous solutions. The biological activity of TGFB2 is measured in culture by its ability to inhibit the mink lung epithelial (Mv1Lu) cells proliferation. ED50 < 40ng/ml, corresponding to a specific activity of 25,000 units/mg.

Amino Acids

HHHHHHALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTI LYYIGKTPKIEQLSNMIVKSCKCS.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCFR, CT (Mast/Stem Cell Growth Factor Receptor, Tyrosine-protein Kinase Kit, Proto-oncogene c-Kit, KIT, CD117)
S0401-25E 200 µL

SCFR, CT (Mast/Stem Cell Growth Factor Receptor, Tyrosine-protein Kinase Kit, Proto-oncogene c-Kit, KIT, CD117)

Sign In for Pricing
View Details
ZNF79, NT (ZNF79, Zinc finger protein 79, ZNFpT7) (FITC)
MBS6367793-01 0.2 mL

ZNF79, NT (ZNF79, Zinc finger protein 79, ZNFpT7) (FITC)

Sign In for Pricing
View Details
ZNF79, NT (ZNF79, Zinc finger protein 79, ZNFpT7) (FITC)
MBS6367793-02 5x 0.2 mL

ZNF79, NT (ZNF79, Zinc finger protein 79, ZNFpT7) (FITC)

Sign In for Pricing
View Details
ELAVL1 Rabbit Polyclonal Antibody (HRP)
orb479904 100 µL

ELAVL1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
GTF3C6 (NM_138408) Human Over-expression Lysate
LY408666 100 µg

GTF3C6 (NM_138408) Human Over-expression Lysate

Sign In for Pricing
View Details
Rno-miR-128-3p miRNA Agomir
orb1916962-01 5 nmol

Rno-miR-128-3p miRNA Agomir

Sign In for Pricing
View Details