Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TGF beta 2 Recombinant Protein

Source : Nicotiana benthamiana. TGFB2 Human Recombinant produced in plants is a homodimeric polypeptide chain containing 2 x 118 amino acids and having a total molecular mass of 27.08kDa. The TGFB2 is fused to 6xHis Tag at N-terminus and purified by proprietary chromatographic techniques. TGFB2 is a 27.08 kDa protein having two identical 118 amino acid peptide chains linked by a single disulfide bond. TGFB2 is part of a family of five related cytokines that have an extensive variation of normal and neoplastic cells, indicating the importance of these homo-dimmer proteins as multi-functional regulators of cellular activity. The three mammalian isoforms of TGF- Beta (TGFb1, TGFb2 and TGFb3) signal through the same receptor and stimulate similar biological responses. They are involved in physiological processes as embryogenesis, tissue remodelling and wound healing.

Product Specifications

Product Name Alternative

Transforming growth factor||beta 2||cetermin||Glioblastoma-derived T-cell suppressor factor||polyergin||G-TSF||TGF-beta2||TGF-beta-2||transforming growth factor beta-2||BSC-1 cell growth inhibitor||TGFB-2.

Purification

Greater than 97.0% as determined by SDS-PAGE.

Components

Lyophilized from a concentrated (1mg/mL) solution containing 50mM Tris-HCl pH-7.4.

Storage Conditions

Lyophilized TGFB2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TGFB2 Human should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) . Please prevent freeze-thaw cycles.

Applications Notes

It is recommended to reconstitute the lyophilized TGFB2 in sterile 18M-cm H2O not less than 1μg/40μl, which can then be further diluted to other aqueous solutions. The biological activity of TGFB2 is measured in culture by its ability to inhibit the mink lung epithelial (Mv1Lu) cells proliferation. ED50 < 40ng/ml, corresponding to a specific activity of 25,000 units/mg.

Amino Acids

HHHHHHALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTI LYYIGKTPKIEQLSNMIVKSCKCS.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pyr-Phe-OH
4011273.0250 250 mg

Pyr-Phe-OH

Sign In for Pricing
View Details
4-ESTREN-6βOL-3, 17-DIONE
503675 Inquire

4-ESTREN-6βOL-3, 17-DIONE

Sign In for Pricing
View Details
Cck (BC028487) Mouse Tagged ORF Clone
MG200794 10 µg

Cck (BC028487) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Mouse Slit homolog 3 protein (Slit3) , partial
MBS1396368-01 0.5 mg (E-Coli)

Recombinant Mouse Slit homolog 3 protein (Slit3) , partial

Sign In for Pricing
View Details
Recombinant Mouse Slit homolog 3 protein (Slit3) , partial
MBS1396368-02 0.05 mg (Baculovirus)

Recombinant Mouse Slit homolog 3 protein (Slit3) , partial

Sign In for Pricing
View Details
Recombinant Mouse Slit homolog 3 protein (Slit3) , partial
MBS1396368-03 0.05 mg (Mammalian-Cell)

Recombinant Mouse Slit homolog 3 protein (Slit3) , partial

Sign In for Pricing
View Details