Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OTOR Recombinant Protein

Source : Escherichia Coli. Otoraplin Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 111 amino acids and having a molecular mass of 12.7 kDa.The OTOR is purified by proprietary chromatographic techniques. OTOR proteins is also known as fibrocyte-derived protein (Fdp) and Melanoma inhibitory activity-like (MIAL) . Otoraplin is a member of the melanoma-inhibiting activity gene family. Otoraplin is a secreted 16 kDa globular protein that is expressed in the inner ear by periotic mesenchyme and developing and mature fibrocytes. OTOR is highly homologous to MIA/cartilage-derived retinoic acid-sensitive protein (CD-RAP), which is a cartilage-specific protein that is also expressed in malignant melanoma cells. The 111 amino acid mature human otoraplin contains 1 SH3 domain (46 - 107 amino acids) and a Tyr at position 50 that is reportedly sulfated. Otoraplin takes pasrt in the initiation of periotic mesenchyme chondrogenesis. Otoraplin is secreted through the Golgi apparatus and plays a role in cartilage development and maintenance. A frequent polymorphism in the translation start codon of OTOR can abolish translation and may be associated with forms of deafness.

Product Specifications

Product Name Alternative

Otoraplin||Fibrocyte-derived protein||Melanoma inhibitory activity-like protein||OTOR||MIAL||FDP||MIAL1||MGC126737||MGC126739.

Purification

Greater than 98.0% as determined by (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Components

The OTOR protein was lyophilized from a concentrated (1mg/mL) solution containing 20mM PBS pH-7.4 and 130mM NaCl.

Storage Conditions

Lyophilized OTOR Recombinant although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution OTOR should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles.

Applications Notes

It is recommended to reconstitute the lyophilized Otoraplin in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.

Amino Acids

VHGIFMDRLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYSKLVKENGAGEFWAGSVYGDGQDEMGVVGYFPRNLVKEQRVYQEATKEVPTTDIDFFCE.

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human Folic acid (FA) ELISA Kit
EIA05643h 1 Kit

Human Folic acid (FA) ELISA Kit

Ask
View Details
Codanin1 discontinued
376220 500 µg

Codanin1 discontinued

Ask
View Details
Human/Rat PKC beta 1 Affinity Purified Polyclonal Ab
AF3759-SP 25 µg

Human/Rat PKC beta 1 Affinity Purified Polyclonal Ab

Ask
View Details
CD142 (CD142 Antigen, Coagulation Factor III, F3, Tissue Factor, TF, TFA, Thromboplastin) (MaxLight 490)
MBS6253427-01 0.1 mL

CD142 (CD142 Antigen, Coagulation Factor III, F3, Tissue Factor, TF, TFA, Thromboplastin) (MaxLight 490)

Ask
View Details
CD142 (CD142 Antigen, Coagulation Factor III, F3, Tissue Factor, TF, TFA, Thromboplastin) (MaxLight 490)
MBS6253427-02 5x 0.1 mL

CD142 (CD142 Antigen, Coagulation Factor III, F3, Tissue Factor, TF, TFA, Thromboplastin) (MaxLight 490)

Ask
View Details
IP-10 (Biotin) discontinued
I8449-03-01 25 µg

IP-10 (Biotin) discontinued

Ask
View Details