Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIF His C Recombinant Protein

Source : Escherichia Coli. MIF human Recombinant, fused to His-tag at C-terminus, was cloned into an E. coli expression vector and was purified to apparent homogeneity by using conventional column chromatography techniques.Macrophage Inducing Factor Human Recombinant is a single, non-glycosylated, polypeptide chaincontaining 123 amino acidsand having a molecular mass of 13.5 kDa. The cytokine Macrophage migration inhibitory factor (MIF) has been identified to be secreted by the pituitary gland and the monocyte/macrophage and to play an important role in endotoxic shock. MIF has the unique property of being released from macrophages and T cells in response to physiological concentrations of glucocorticoids. The secretion of MIF is tightly regulated and decreases at high, anti-inflammatory steroid concentration.

Product Specifications

Product Name Alternative

Phenylpyruvate tautomerase||Glycosylation-inhibiting factor||GIF||MMIF||MIF.

Purification

Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Components

Human MIF was lyophilized from a 1mg/mL solution containing PBS pH-7.4.

Storage Conditions

Lyophilized MIF although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MIF should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles.

Applications Notes

It is recommended to reconstitute the lyophilized MIF in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions. Measured by its ability to bind rhCD74 in a functional ELISA.

Amino Acids

MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFALEHHHHHH.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-SOX5 Antibody Picoband® (Dylight488 Conjugate)
PB9507-Dylight488 100 µg

Anti-SOX5 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
KCND3 Rabbit Polyclonal Antibody
orb1176114 100 µg

KCND3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Smooth Muscle Basal Medium
SMCM001 500 mL

Smooth Muscle Basal Medium

Sign In for Pricing
View Details
VAMNE MagUltra FFPE DNA Extraction Kit (Prepackaged)
DM602-01 4x 16 Tests

VAMNE MagUltra FFPE DNA Extraction Kit (Prepackaged)

Sign In for Pricing
View Details
Rat tumor necrosis factor-inducible gene 6 protein ELISA Kit
GTR10331022 96 Well

Rat tumor necrosis factor-inducible gene 6 protein ELISA Kit

Sign In for Pricing
View Details
EPHB3 (EPH Receptor B3, ETK2, HEK2, TYRO6) (AP) discontinued
245779-AP 100 µL

EPHB3 (EPH Receptor B3, ETK2, HEK2, TYRO6) (AP) discontinued

Sign In for Pricing
View Details