Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIF His N Recombinant Protein

Source : Escherichia Coli. MIF human Recombinant, fused to His-tag at N-terminus, was cloned into an E. coli expression vector and was purified to apparent homogeneity by using conventional column chromatography techniques. Macrophage Inducing Factor Human Recombinant is a single, non-glycosylated, polypeptide chain having amino acids from 1-114 and having a molecular mass of 16.6 kDa. The cytokine Macrophage migration inhibitory factor (MIF) has been identified to be secreted by the pituitary gland and the monocyte/macrophage and to play an important role in endotoxic shock. MIF has the unique property of being released from macrophages and T cells in response to physiological concentrations of glucocorticoids. The secretion of MIF is tightly regulated and decreases at high, anti-inflammatory steroid concentration.

Product Specifications

Product Name Alternative

Phenylpyruvate tautomerase||Glycosylation-inhibiting factor||GIF||MMIF||MIF.

Purification

Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Components

1mg/mL solution containing PBS pH-7.4.

Storage Conditions

Liquid MIF although stable 4°C for 1 week, should be stored below -18°C. Please prevent freeze-thaw cycles.

Amino Acids

MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMPMFIVNTNV PRASVPDGFL SELTQQLAQA TGKPPQYIAV HVVPDQLMAF GGSSEPCALC LHSIGKIGGA QNRSYSKLLC GLLAERLRIS PDRVYINYYD MNAANVGWNN STFA.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DFNA53 Recombinant Protein (Human)
RP054714 100 µg

DFNA53 Recombinant Protein (Human)

Sign In for Pricing
View Details
CD62 Antigen-Like Family Member L (CD62L) Antibody (RPE)
abx412875 25 Tests

CD62 Antigen-Like Family Member L (CD62L) Antibody (RPE)

Sign In for Pricing
View Details
Anti-PKA R2/PKR2/PRKAR2A Antibody Picoband® Fluoro647 Conjugated
A03911-2-Fluoro647 100 µg/Vial

Anti-PKA R2/PKR2/PRKAR2A Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
HRO761 (Werner syndrome RecQ helicase-IN-1) 50mg
A24144-50 50 mg

HRO761 (Werner syndrome RecQ helicase-IN-1) 50mg

Sign In for Pricing
View Details
NLG1 Rabbit Polyclonal Antibody (BF488)
orb2398297 100 µL

NLG1 Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
Cytokeratin 7 Rabbit pAb
MBS8542803-01 0.1 mL

Cytokeratin 7 Rabbit pAb

Sign In for Pricing
View Details