Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIF (Active) Recombinant Protein

Source : Escherichia Coli. MIF human Recombinant was cloned into an E.coli expression vector and was purified to apparent homogeneity by using conventional column chromatography techniques.Macrophage Inducing Factor Human Recombinant is a single, non-glycosylated, polypeptide chain containing 115 amino acids and having a molecular mass of 12.5 kDa. The cytokine Macrophage migration inhibitory factor (MIF) has been identified to be secreted by the pituitary gland and the monocyte/macrophage and to play an important role in endotoxic shock. MIF has the unique property of being released from macrophages and T cells in response to physiological concentrations of glucocorticoids. The secretion of MIF is tightly regulated and decreases at high, anti-inflammatory steroid concentration.

Product Specifications

Product Name Alternative

Phenylpyruvate tautomerase||Glycosylation-inhibiting factor||GIF||MMIF||MIF.

Purification

Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Components

MIF-Protein was lyophilized from 10mM sodium phosphate buffer pH-7.5.

Storage Conditions

Lyophilized MIF-protein although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MIF-protein should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles.

Applications Notes

It is recommended to reconstitute the lyophilized MIF-Protein in sterile 18MΩ-cm H2O at a concentration between 0.1mg-1mg per 1ml. Human PBMCs were cultured with 0 to 1000ng/ml Human MIF. Production of IL-8 was measured via ELISA after 24 hours. The ED50 which was found to be 88-132ng/ml.

Amino Acids

MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA.

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

OR13H1 (NM_001004486) Human Tagged ORF Clone Lentiviral Particle
RC216119L4V 200 µL

OR13H1 (NM_001004486) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
Mouse cytosolic phospholipase A2 (cPLA2) ELISA Kit
YP-W20200-01 48 Tests

Mouse cytosolic phospholipase A2 (cPLA2) ELISA Kit

Ask
View Details
Mouse cytosolic phospholipase A2 (cPLA2) ELISA Kit
YP-W20200-02 96 Tests

Mouse cytosolic phospholipase A2 (cPLA2) ELISA Kit

Ask
View Details
TPX2, ID (TPX2, C20orf1, C20orf2, DIL2, HCA519, Targeting protein for Xklp2, Differentially expressed in cancerous and non-cancerous lung cells 2, Hepatocellular carcinoma-associated antigen 519, Protein fls353, Restricted expression proliferation-associa
MBS6357799-01 0.1 mL

TPX2, ID (TPX2, C20orf1, C20orf2, DIL2, HCA519, Targeting protein for Xklp2, Differentially expressed in cancerous and non-cancerous lung cells 2, Hepatocellular carcinoma-associated antigen 519, Protein fls353, Restricted expression proliferation-associa

Ask
View Details
TPX2, ID (TPX2, C20orf1, C20orf2, DIL2, HCA519, Targeting protein for Xklp2, Differentially expressed in cancerous and non-cancerous lung cells 2, Hepatocellular carcinoma-associated antigen 519, Protein fls353, Restricted expression proliferation-associa
MBS6357799-02 5x 0.1 mL

TPX2, ID (TPX2, C20orf1, C20orf2, DIL2, HCA519, Targeting protein for Xklp2, Differentially expressed in cancerous and non-cancerous lung cells 2, Hepatocellular carcinoma-associated antigen 519, Protein fls353, Restricted expression proliferation-associa

Ask
View Details
Rat Agmatine Ureohydrolase/Agmatinase (AGMAT) ELISA Kit
MBS2805514-01 48 Tests

Rat Agmatine Ureohydrolase/Agmatinase (AGMAT) ELISA Kit

Ask
View Details